KEGG   Debaryomyces hansenii: DEHA2F24882gHelp
Entry
DEHA2F24882g      CDS       T01026                                 

Definition
DEHA2F24882p
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
dha  Debaryomyces hansenii
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:dha00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    DEHA2F24882g
Enzymes [BR:dha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     DEHA2F24882g
Peptidases [BR:dha01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   DEHA2F24882g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:2062739..2065480
Genome map
AA seq 913 aa AA seqDB search
MTSGTVKFRSLGELRSLSSTMTNDLISSTRKIPKLLGHQVSLIEIFTHESKKLEKLGYCD
YELALVSFDISVALYKFCEKAVTIETKGFLDDIKVTLASKKSKYEHLIEAFSGTSKSEDS
NDTNGSVDPLLARFNNLKSPSPSESEDGPQGSHTEFINIDAFKYKEFINPAELHELLFSE
GYSSKNVLLIDFRTRKEFNYNHINYSEIVNIEPDWVNSLLGSSKEAHDIVDQTLEARLEM
LLPSEQYKRFLKRFTYDLVVVYNLRYGPGIEEEDRFTSLKNSLINGDSNGIAVQCPIQKL
IDIITYKNKYISSKLKRHPCILAGGVKAWYDMFGEKYILKTNATQILARPEASLSRGGSE
SSISRRNDNKTPEESISPERSSSPYLKNFGEYLSTAKSTNTPISNSFSPSTLMAATTSSI
NSNTSSSFQNSTNSRSSSSGGSFIDGENLNSSPPQQQKPKLASSSPRRESNSSVSNLSQT
FTNSLSSSKSSSTNESSLTSKNNNTIKFLEQYTTGLTNLGNSCYMNCILQCLAATPQLTK
FFFPNISSSSLPSSSSLQSYRQHINVNNKLGSKGILTTNFVNLLMNMFTNVGKYFTPTSF
KKVVGSLSPGQQFATFDQQDCIEFLNFILDGLHEDLNQMLISDPEEKKTILELTPEQEKT
REFLPVRLASTIEWERYLKLNFSIIVDFFQGQYLSQLKCLECGLTSTTYNAFSILSLPIP
EKLGSLKDVSLHDCLEGFVTTELLDDDNKWHCPSCKRFTKSTKKITITRLPQVLIIHFKR
FKINSKGYFNKLDTFINYPVNDVLDLTSYWPDVGTSVNSNLKSNEKISKEKEKQILSTLP
TRNQQPPFRYKLYGVANHFGNLSTGHYTSYVYKQSDSKKTRDWCYFDDAKVTYNCKESQV
LNRNAYCLFYQRI
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atgacgtctggaacagtgaagttcagatcactcggtgagcttagatcattatcctcgacg
atgacaaatgatcttatctcaagcactcgtaagatacccaaacttttaggacatcaagtt
tcgcttatagagatattcactcatgaatcaaagaagttagaaaagttggggtattgcgat
tacgagttagcattggtaagctttgatatctcagtggcgttatataaattttgcgagaaa
gcagtaaccatagagacaaaagggtttcttgacgatataaaggttactttagcgagtaaa
aaaagcaaatatgaacatttaatagaggcattttcaggtacttcgaaatccgaggactct
aatgacaccaatggatctgtggaccccttattggcgaggtttaacaaccttaaaagccct
tcgccgctggaatcggaagatggtcctcaaggatctcatacggagttcataaacatagat
gcatttaaatacaaggagtttatcaatccagctgaactacatgaattacttttcctggaa
ggttattcatcgaaaaacgttttattgattgattttaggactaggaaagaatttaattac
aatcacataaactattctgaaatagtgaatattgaacccgattgggtcaatagtttgtta
ggatctctgaaggaggcccatgatattgttgaccaaactttagaggccagactagaaatg
ctacttccatcagaacaatataaaaggtttttgaaacgattcacttacgatttagtggtt
gtatataatttgcgttatggtccgggtatagaagaagaagataggtttacgtcactcaag
aacctgttgatcaacggggattcgaacggtattgctgtgcaatgtccaattcaaaaatta
attgatataataacatacaagaacaaatatataagttcaaaactaaaacgccatccttgc
attttggcaggtggtgtaaaagcttggtatgatatgtttggagaaaaatatattttgaag
actaatgctacccagatccttgctagacctgaagcttcattgtcaagaggtggtagtgaa
tcatctatatctagacggaacgacaataaaactccagaagagtcgataagcccagaaaga
tcttcgtcaccatatctcaagaacttcggtgaatatttatctacggcaaagtcaacgaat
actccaatatcaaattcattctcgccttcaacattaatggcggcaactacgtctagtata
aattcaaacacatcatcaagttttcaaaattccactaacctgcgttcttcttccctggga
ggttcgtttatagatggtgaaaacttaaactcatctccacctcaacagcagaaaccaaaa
cttgcctcatcttctcccagaagagaatcgaattcatctgtatcaaatttatctcaaact
ttcaccaattcacttagctcatctaaatctagttcaactaatgaaagttctcttacgtct
aagaacaacaacaccattaaattcttggaacagtatacgacaggcctcacaaatcttggt
aattcttgttacatgaattgcattcttcaatgtttagctgctactccacaattaaccaaa
tttttctttccaaatatatcaagctcgtctttaccatcgtcctcatcccttcaatcatat
cgtcagcatattaatgtaaacaataaattggggtctaagggaattttaacgacaaacttt
gttaatctattgatgaacatgtttacaaatgttggtaaatatttcaccccaaccagcttc
aagaaggtagttggatcattatctcctggtcaacagttcgctacatttgatcaacaagat
tgtatcgaatttttaaactttatattagatggattacatgaagacttgaatcaaatgcta
atttctgatcctgaagaaaagaaaactatcttggaattgaccccagaacaagaaaaaact
agggaattccttcctgttagattggcctcaaccattgaatgggagagatatcttaagtta
aacttctcaattattgttgatttctttcaaggtcaatatttatcacaattgaagtgttta
gaatgtggtctaacatcaacgacatacaatgcattcctgatactatctttaccaattcca
gaaaaacttggttcccttaaagatgttctgttacatgattgtttagaaggttttgttact
actgaattgctagatgatgataataaatggcattgtcctagctgcaagagatttacaaag
ctgacaaagaaaattaccatcactagattaccccaggtattaatcattcacttcaaaagg
ttcaaaattaatagcaaagggtattttaataagcttgatacattcataaattatccggtc
aatgatgtgttagatcttacttcttactggcccgacgttggtacatcagttaatagtaat
cttaagtcaaatgaaaaaatatcgaaggagaaggaaaagcagattttgtcgaccttacct
acgagaaatcaacaacctccattcagatacaaactttatggtgtggcaaatcacttcggt
aatctatcaactggacactacacctcctatgtttataagcaaagtgattcaaaaaagacg
agggattggtgttattttgatgatgctaaggtaacttacaactgtaaggagagccaagtg
ttgaatagaaatgcatactgtttattttatcaacgtatttag

DBGET integrated database retrieval system