KEGG   Debaryomyces hansenii: DEHA2F26840gHelp
Entry
DEHA2F26840g      CDS       T01026                                 

Definition
DEHA2F26840p
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
dha  Debaryomyces hansenii
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dha00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:dha00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:dha00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:dha00603]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:2241885..2243138
Genome map
AA seq 417 aa AA seqDB search
MVFLKKLAAISTLLLGSTQAYENGLGLTPQMGWNSWNIYGCDINETIIIGAAEKIKELGL
QDLGYEYIVMDDCYQLHERDNTTNKILADPEKFPNGIKHLADSIHDLGFKFGMYSSAGRY
TCGGYPGSLHNEELDADTFADWGIDYLKYDNCYNEGNSGTAQISYKRYDKMAKALNATGR
PIFYSLCQWGEDNVWNWGSTVSNSWRISGDIYDHFDRYDDRCPCESYECLGLQGYMCSMT
NILEKAVPLGQKAGTGQGWNDLDSLEVGNGGMNYDEYVAHFTLWAILKSPLVLGNDVTNM
TDEDLGIVKNAQIIEINQDLSAPAHRVWKKSVKGGSLQLFATTLSDETQIVAIFNSGDYE
EDTELLFEDIFVDDLTMKNKSYSGKELWTNETSTFEDKISTSVKTHSIKIWKLTEAN
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggttttccttaaaaaacttgcagctatctcgacgcttctccttggttctacacaagcc
tacgaaaatggattaggacttacaccacaaatggggtggaattcttggaatatttatggc
tgtgatattaatgagacaatcattattggagcagctgaaaaaataaaggaattagggtta
caagatcttgggtatgagtatattgtcatggatgattgttaccaattacatgaaagagac
aataccacgaacaagattctagctgatcctgaaaaatttcccaatggtatcaagcacctc
gccgattctattcatgatttaggatttaagtttggtatgtattcttctgctggtaggtat
acatgcggagggtatcctggatctttacataacgaagaactagatgctgatacatttgca
gattggggaattgattatttgaaatatgataattgctacaatgaagggaacagtggtaca
gcgcaaatcagctataagaggtatgataaaatggccaaagctttgaatgccactggaaga
cccattttctactccttgtgtcaatggggggaagataatgtatggaattgggggtctacg
gtttcaaactcctggagaatttctggggatatatatgatcactttgatcgttatgacgac
cgctgtccttgtgaatcttacgaatgtcttggtctacagggttacatgtgctccatgact
aacatattagagaaagctgttcctcttggacaaaaagcaggaacaggtcagggatggaac
gacttagatagtcttgaagtaggaaatggtggaatgaattatgatgagtatgttgctcat
tttacactttgggctatattgaaaagtcctttagttttaggtaatgatgttacaaatatg
actgacgaagacttgggtatcgttaaaaatgctcaaataattgagattaatcaagattta
tctgccccagcacacagagtttggaaaaaatctgtcaaaggaggatcacttcaattattt
gcaactactttgtctgatgagacacaaattgtagcaatttttaacagcggtgattatgaa
gaagacacagaacttttatttgaagatatttttgttgatgacttgacaatgaaaaacaaa
tcgtattctggtaaagaattatggacgaatgaaacttcaacatttgaagataaaattagt
acttctgtcaaaacacactccattaagatttggaagttgactgaggccaattaa

DBGET integrated database retrieval system