KEGG   Debaryomyces hansenii: DEHA2F26840gHelp
Entry
DEHA2F26840g      CDS       T01026                                 

Definition
DEHA2F26840p
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
dha  Debaryomyces hansenii
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    DEHA2F26840g
  Lipid metabolism
   00561 Glycerolipid metabolism
    DEHA2F26840g
   00600 Sphingolipid metabolism
    DEHA2F26840g
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    DEHA2F26840g
Enzymes [BR:dha01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     DEHA2F26840g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:2241885..2243138
Genome map
AA seq 417 aa AA seqDB search
MVFLKKLAAISTLLLGSTQAYENGLGLTPQMGWNSWNIYGCDINETIIIGAAEKIKELGL
QDLGYEYIVMDDCYQLHERDNTTNKILADPEKFPNGIKHLADSIHDLGFKFGMYSSAGRY
TCGGYPGSLHNEELDADTFADWGIDYLKYDNCYNEGNSGTAQISYKRYDKMAKALNATGR
PIFYSLCQWGEDNVWNWGSTVSNSWRISGDIYDHFDRYDDRCPCESYECLGLQGYMCSMT
NILEKAVPLGQKAGTGQGWNDLDSLEVGNGGMNYDEYVAHFTLWAILKSPLVLGNDVTNM
TDEDLGIVKNAQIIEINQDLSAPAHRVWKKSVKGGSLQLFATTLSDETQIVAIFNSGDYE
EDTELLFEDIFVDDLTMKNKSYSGKELWTNETSTFEDKISTSVKTHSIKIWKLTEAN
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggttttccttaaaaaacttgcagctatctcgacgcttctccttggttctacacaagcc
tacgaaaatggattaggacttacaccacaaatggggtggaattcttggaatatttatggc
tgtgatattaatgagacaatcattattggagcagctgaaaaaataaaggaattagggtta
caagatcttgggtatgagtatattgtcatggatgattgttaccaattacatgaaagagac
aataccacgaacaagattctagctgatcctgaaaaatttcccaatggtatcaagcacctc
gccgattctattcatgatttaggatttaagtttggtatgtattcttctgctggtaggtat
acatgcggagggtatcctggatctttacataacgaagaactagatgctgatacatttgca
gattggggaattgattatttgaaatatgataattgctacaatgaagggaacagtggtaca
gcgcaaatcagctataagaggtatgataaaatggccaaagctttgaatgccactggaaga
cccattttctactccttgtgtcaatggggggaagataatgtatggaattgggggtctacg
gtttcaaactcctggagaatttctggggatatatatgatcactttgatcgttatgacgac
cgctgtccttgtgaatcttacgaatgtcttggtctacagggttacatgtgctccatgact
aacatattagagaaagctgttcctcttggacaaaaagcaggaacaggtcagggatggaac
gacttagatagtcttgaagtaggaaatggtggaatgaattatgatgagtatgttgctcat
tttacactttgggctatattgaaaagtcctttagttttaggtaatgatgttacaaatatg
actgacgaagacttgggtatcgttaaaaatgctcaaataattgagattaatcaagattta
tctgccccagcacacagagtttggaaaaaatctgtcaaaggaggatcacttcaattattt
gcaactactttgtctgatgagacacaaattgtagcaatttttaacagcggtgattatgaa
gaagacacagaacttttatttgaagatatttttgttgatgacttgacaatgaaaaacaaa
tcgtattctggtaaagaattatggacgaatgaaacttcaacatttgaagataaaattagt
acttctgtcaaaacacactccattaagatttggaagttgactgaggccaattaa

DBGET integrated database retrieval system