KEGG   Debaryomyces hansenii: DEHA2G04444gHelp
Entry
DEHA2G04444g      CDS       T01026                                 

Definition
DEHA2G04444p
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
dha  Debaryomyces hansenii
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:dha03013]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:complement(383959..384819)
Genome map
AA seq 286 aa AA seqDB search
MSWDDEDFDIPSNSKQAAASWEEEGNDEPLLDSWDIDEEEVARKKKEEEAKKKAEKEALK
KKQEESKAKKLSKNKGQRALLDIDLVDENTRQELLKKAELDADLNNAADLFGGLGVAGEG
GMDINEHPRERAAKAAAAAAAASGPTPARLTKDTPIDTHPLFQPTDRQEYEKLRKALAPV
LTNLAEDSLMNYSSGLAIDLIRDLAQPLSIESIRKVVSTLNVISKEKEKAERQARLKKAG
GTATGGAGKKKAKPAVKTNVNTSFKQDVFDDIDQSKYDEFEEDDFM
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgggacgatgaagactttgatattccaagcaattccaagcaagctgctgcatct
tgggaagaggaaggtaacgatgaaccattattagactcgtgggatatagacgaagaagaa
gttgcgcgtaagaagaaggaagaagaagctaaaaagaaggcagaaaaggaagctttgaag
aagaaacaagaagaatctaaggctaagaaattgtctaagaacaagggacaaagggcttta
ttggatatcgatttggttgacgaaaacaccagacaagaactcttgaagaaggcagagtta
gacgccgatttgaataatgctgctgatttatttggaggattaggtgttgctggtgaaggg
ggaatggatatcaacgaacatccaagggaaagagcagctaaggccgctgctgcggctgct
gctgcttcaggccctactcctgccagattgaccaaggatactccaatcgatactcaccca
ttattccaaccaaccgatagacaggaatacgaaaaattgagaaaggctttggctccagtt
ttgaccaacttggcagaagactcgttaatgaactactcttctgggttagctattgatttg
ataagagatttagcccaaccattatctattgaaagcataagaaaggtcgtatcgactttg
aatgttatcctgaaggaaaaggaaaaggctgaaagacaggctagattgaagaaggctggt
ggtactgccactggtggtgcaggtaaaaagaaggccaagccagctgtgaagactaacgtc
aacacatcgttcaagcaggatgtctttgacgacatagatcaatctaagtacgacgaattt
gaagaggatgacttcatgtaa

DBGET integrated database retrieval system