KEGG   Debaryomyces hansenii: DEHA2G07898gHelp
Entry
DEHA2G07898g      CDS       T01026                                 

Definition
(RefSeq) DEHA2G07898p
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
dha  Debaryomyces hansenii
Pathway
dha00230  Purine metabolism
dha01100  Metabolic pathways
Module
dha_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    DEHA2G07898g
Enzymes [BR:dha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     DEHA2G07898g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_33 AAA_18 AAA_22 RNA_helicase MMR_HSR1 AAA_28 AAA_24 ABC_tran DUF2075 ATPase_2 AAA RsgA_GTPase AAA_14 AAA_30 NACHT AAA_29 T2SSE NTPase_1 Viral_helicase1 KAP_NTPase MobB Rad17 Cytidylate_kin Adeno_IVa2 cobW AAA_23 AAA_5
Motif
Other DBs
NCBI-GeneID: 2904772
NCBI-ProteinID: XP_461891
UniProt: Q6BIT0
Position
G:complement(665598..666158)
Genome map
AA seq 186 aa AA seqDB search
MSRPIVISGPSGTGKSTLLKKLFAEFPDRFGFSVSNTTRQPRAGETDGVEYNFSTVDGFK
QAIEEKKFIEWTQFSGNYYGTSFKAVDDVTKKGRTCILDIEMDGVKAVKASNLNARFLFL
SPPSIEILRQRLEGRGTETQDSIEKRISAAKAEMDFAKTGAHDRIIVNDDLDKAYVEFKD
FILAEN
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgagcagacctatcgttatctcaggaccatcaggaaccggaaaatctactttattgaag
aagttattcgccgaatttccagacagatttggattctctgtctcgaacacaaccagacaa
ccaagagctggagaaacagatggagttgaatacaactttagcactgtcgacggtttcaaa
caggctatcgaagaaaagaaatttatcgaatggacgcagttttctggtaattactacggc
acttctttcaaagccgttgacgacgtcaccaagaagggtagaacatgtatcttggacatt
gaaatggatggagttaaggcagtcaaggcttctaacttgaacgctagattcttgttcttg
agtccaccttctattgagatcttaagacaaagattagagggaagaggtactgaaacccaa
gattccatcgaaaaaagaatcagtgctgctaaggctgaaatggattttgctaagacagga
gctcacgatagaattattgtcaatgacgacttagataaggcgtacgttgaattcaaggat
tttattttggctgaaaactaa

DBGET integrated database retrieval system