KEGG   Debaryomyces hansenii: DEHA2G07898gHelp
Entry
DEHA2G07898g      CDS       T01026                                 

Definition
DEHA2G07898p
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
dha  Debaryomyces hansenii
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:dha00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:complement(665598..666158)
Genome map
AA seq 186 aa AA seqDB search
MSRPIVISGPSGTGKSTLLKKLFAEFPDRFGFSVSNTTRQPRAGETDGVEYNFSTVDGFK
QAIEEKKFIEWTQFSGNYYGTSFKAVDDVTKKGRTCILDIEMDGVKAVKASNLNARFLFL
SPPSIEILRQRLEGRGTETQDSIEKRISAAKAEMDFAKTGAHDRIIVNDDLDKAYVEFKD
FILAEN
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgagcagacctatcgttatctcaggaccatcaggaaccggaaaatctactttattgaag
aagttattcgccgaatttccagacagatttggattctctgtctcgaacacaaccagacaa
ccaagagctggagaaacagatggagttgaatacaactttagcactgtcgacggtttcaaa
caggctatcgaagaaaagaaatttatcgaatggacgcagttttctggtaattactacggc
acttctttcaaagccgttgacgacgtcaccaagaagggtagaacatgtatcttggacatt
gaaatggatggagttaaggcagtcaaggcttctaacttgaacgctagattcttgttcttg
agtccaccttctattgagatcttaagacaaagattagagggaagaggtactgaaacccaa
gattccatcgaaaaaagaatcagtgctgctaaggctgaaatggattttgctaagacagga
gctcacgatagaattattgtcaatgacgacttagataaggcgtacgttgaattcaaggat
tttattttggctgaaaactaa

DBGET integrated database retrieval system