KEGG   Debaryomyces hansenii: DEHA2G08470gHelp
Entry
DEHA2G08470g      CDS       T01026                                 

Definition
DEHA2G08470p
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
dha  Debaryomyces hansenii
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    DEHA2G08470g
Enzymes [BR:dha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     DEHA2G08470g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:710266..712263
Genome map
AA seq 665 aa AA seqDB search
MKWLIIIYAIVILAIGASAKSPSGGYAPGKAKCPSKKSLLREAKSISSEEKKWLKERQKK
TNQALITYLDNANLTDFDAEGFLGQNTSSSVNIGLAFSGGGYRAMLVGAGQLAALDNRTE
NADTHGLGGILQSSSYISALSGGAWLLGSLAMQEWPSVQDVVMHNPNDLWNLTFSRQLVN
QTSLLGLSVPLLTANLSEALTHLNHWQDDDGKGIGYDLISKSEAGFNTTLTDAWARALAY
QLSTEGKDDYGSSATFSDIRDKKSFANHEMPFPILNALARQPDSILYDENSTVIEFNPYE
MGSFDSSINSFTDIKYLGTNVNNGVPVNGTCIEGFDNAGFIMGTSSSLFNQFLNTLACDD
CTTLNFLLKPLVKRVLTKLSRSYEDVALYKPNPFYRSEHATPGKLIKNESLYLIDGGLGG
QTIPLATMMTKERAMDAVFAFDNDAWSNGSSLVATYARQFSNHGKSQICPYVPDEQNFLY
QNLTAKPTFFGCDASNMTDLVKDGVIPPVVIYIANRPFEYMTNTSTFKMMYTDKEKKAMV
QNGFDTATRANMTIDEEWAACVGCAVIRREQERRGLEQSDQCKKCFKDYCWNGDRVIFDR
TYYTPVNFTMTGKTNGSMDVDTIRDPDLLTGVSSLLKKRDTGDVPMLLSPEEDDDHTEKI
VPIIP
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggttaataattatatacgcaatagtaatattggccattggtgcgagtgcaaaa
tcacctagtggtgggtacgctcccggaaaggctaaatgcccgagtaagaaaagtttatta
agagaagccaaatcaatatccagtgaagaaaagaaatggctcaaggaaagacaaaagaaa
actaaccaagcattgataacctatttagataatgctaatttaactgactttgatgctgaa
ggatttctcgggcagaatacgtcgctgagtgtaaatattggattggcattttccggcgga
gggtatagggcgatgttagttggggctggccagttggccgcgttggataataggacggaa
aatgctgatacgcatggccttggaggaatactacaaagctcgtcttatatcagtgcattg
tcaggtggtgcctggttgctaggatcgttggcaatgcaagagtggccttcggttcaggat
gtcgtgatgcataatcctaatgatctttggaatttaactttcagcaggcaacttgttaat
cagactagtctacttggacttagtgtaccattattaactgcaaatttgagtgaagctttg
actcatttaaatcactggcaagacgatgatggcaagggaattggatacgatttgatatcc
aaaagtgaggcaggattcaacacaaccttaacagatgcgtgggcgagagcattagcttat
cagctatccaccgaaggtaaggatgattatggatcatctgcaaccttttccgatattaga
gataagaagagttttgcaaaccatgaaatgccgttccctattttaaatgctcttgcaagg
caaccagactctattttatacgatgaaaattctactgtcattgagtttaatccctatgaa
atgggttcatttgattcatccataaattcgtttactgatattaagtatcttggaactaac
gtgaacaatggggttccagtaaatggtacatgcattgaaggctttgacaatgcaggcttt
attatgggtacttcatcctcattattcaatcaatttttaaatacgttagcctgtgatgat
tgtacaactttgaatttccttttaaagccattagtgaaacgagtattaaccaaattatcc
agatcctacgaggatgttgcactttacaagccaaatccattctataggtctgaacatgcc
actccgggaaaacttatcaaaaatgaatctctctacctcatcgatggtggattaggtgga
caaactattccattagcaaccatgatgacaaaggaaagagctatggatgcggtatttgcg
tttgataacgatgcatggtcaaatggatcatcattagtggcaacatacgcaaggcaattc
tctaaccatggtaaatcacaaatttgcccttatgttcctgacgaacaaaactttttatac
caaaatttaacagccaaaccaacattctttggctgcgacgcttccaacatgacggatttg
gtaaaggacggagttattcctcccgtggtcatctacatagctaacagaccttttgagtac
atgacgaatacttcaacgttcaagatgatgtacactgacaaggaaaagaaagccatggtg
cagaatggatttgatactgcaaccagggccaacatgacaattgacgaagaatgggctgct
tgtgtcggctgtgcagttatcaggcgtgaacaagaaagaaggggcttggagcaatcagac
caatgtaaaaagtgctttaaagactactgctggaacggagatagagtaatattcgatcgt
acctactatactccagtgaatttcacaatgactggtaaaacaaatggaagcatggacgtg
gatacgatccgtgatcctgatttgttgactggtgtatcatctctcttgaagaaaagagac
acaggagatgttccgatgcttctttcgccagaagaagatgatgatcatactgaaaaaatt
gtaccaataattccttaa

DBGET integrated database retrieval system