KEGG   Debaryomyces hansenii: DEHA2G08778gHelp
Entry
DEHA2G08778g      CDS       T01026                                 

Definition
DEHA2G08778p
Orthology
K11401  
histone acetyltransferase SAS2 [EC:2.3.1.48]
Organism
dha  Debaryomyces hansenii
Brite
Enzymes [BR:dha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     DEHA2G08778g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:738184..739260
Genome map
AA seq 358 aa AA seqDB search
MSATAKSNPKSSKYEEDNEFYGVLNEPNIGKVVLGNYEFDTWYGNAAYFSSQGPHSILGY
EFLNKIVTATGQKGKKKVIDQITETESIKPKNDSLWLDKLYVCQYCFKYTDKQQFMGQHQ
AVCPLNTRFPSIGKLLYRDDESPYFITHVRGFKHQLFCQNLSLFGKLFLDDKSVYYNVDA
FDYYIIYGLDQHQDSSYPEENFVPMGFFSKEVLSWDDDNNLACICIFPPFQRRHLGSLLI
EFSYALARVTPGQFRSGPEFPLSPYGKMSYLHYWSRKLAYILLQTFKINEEFNLSSLADI
TGFRKEDILLTLEYMQILQDTGNGNVSLSLGNFNQWCTENNVDPLQEKTMLNPNYLLI
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgctggcaactgctaaatccaatcccaaatcatcgaagtatgaggaagataatgaattc
tacggtgttttgaacgagccaaatatagggaaagttgttcttggaaattatgagttcgat
acttggtatggtaatgcagcatatttcagttcccaaggacctcattctatattgggatat
gaatttttaaacaaaatagtaactgctacggggcaaaaaggtaaaaagaaggtgattgat
caaataactgaaacggagagtattaaaccaaagaatgattcgttgtggttagataaacta
tatgtctgtcaatactgttttaagtatacagataaacaacaatttatgggacagcatcaa
gctgtatgccctttgaatactaggttcccttctattggaaagttgttatatagggacgac
gaatcaccatacttcattactcatgtcagagggttcaagcatcagctattttgtcagaat
ctttcattattcgggaagctatttcttgatgataaatcagtatattataatgttgatgca
tttgactactacataatatatggcctcgatcaacatcaagacctgtcatatccagaagag
aattttgtaccaatgggattcttttcgaaagaagtgctatcgtgggatgacgataataac
ttagcgtgtatatgtatatttcccccattccaaaggcgacatcttggttccctcttgata
gaatttctgtacgcattggccagagttacaccaggccaattcagaagtgggcccgagttc
cccttgtctccctatggtaaaatgagttatttacattattggtcaagaaaattggcatat
atcctattgcaaaccttcaaaataaatgaagaatttaacttgtcgagtctagcagatatt
accggtttcaggaaagaagatattttgcttactttggaatatatgcaaatattacaagat
actggtaatggtaatgtcagtttatcattgggtaattttaatcaatggtgcactgaaaat
aatgtcgatcctttgcaagagaagaccatgttgaacccaaactaccttttaatttaa

DBGET integrated database retrieval system