KEGG   Debaryomyces hansenii: DEHA2G08844gHelp
Entry
DEHA2G08844g      CDS       T01026                                 

Definition
DEHA2G08844p
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
dha  Debaryomyces hansenii
Brite
Enzymes [BR:dha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     DEHA2G08844g
Peptidases [BR:dha01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   DEHA2G08844g
Exosome [BR:dha04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   DEHA2G08844g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:complement(745057..747438)
Genome map
AA seq 793 aa AA seqDB search
MATCKHIIDQSSGLSSEIALNTKVFKDDCMYCFDTPENNPSGLDICLQCFQSFSRGDINH
TRKHYDNTEHAYYLNVVKELKPDAERNQFPKNEEGERKQKIAKLEIKDTQEEDIYNITKS
VYCLDCDQSYSIEDSPENIQRLIENVLKSNSSARDDEIKAWEQEVFPCAHSVDIEQFPNN
SVDLSVCAQCDLKENLWICLHCGIIGCGRQQFGSALQGNSHALTHYELSGHPVAVKLGSL
SADDVNNCDCYCYQCQDEVKVNDLYEKLLKYGIDLAKSVKTEKNLIELNLDQNLNWEFKL
DGANGEKLEPVFGKDLTGFQNLGNSCYLNSVLQALFSLPNYQQYFGKQEFPSYKEVQDPS
KDLLSQLIKVHDGLLSGRYSRPNSLKGDDYQLGIKPSTFKSLIGENHSEFKTQKQQDSFE
FLLYLLDKIDNELGLNLNRPMKFLMGSKVVCSKCLHGKISMELIDNVSVPIDDEIESIDQ
ETGKKTYKETNIVDSFKNYCAEEAVEDFKCDSCDSPSSTAIKSTGFKTFPDVLVVNARRI
KLENWVPAKVDVPISIPGSIDLSRFTAPQAASGETISSETENENDSKEFIPNEEGMSMLL
SMGFPEVRCVKGLYNTGNNNAEDAMNWILAHMDDIDIDEPFTPSDSNVSSTDPSQDSIDN
LVAMGFSNQLSKKSLILNKNDINAAVEWLFSNPDDDGVIEDSKPIINVAQECKELTQDLL
DNPPSNDGRYDAKAVICHKGSSPHTGHYVVYIRKLINNESKWVLFNDEKVVACDDASISD
IKETGYIYIFEKK
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atggctacatgtaaacatattatagaccaatcttctggattatcatctgaaatagcactt
aatacaaaagtgtttaaggatgattgtatgtactgctttgatacgccagaaaataatcct
tcaggattagatatttgtttacaatgcttccaatctttctccagaggagatattaatcac
acccgaaagcattatgataatacggagcatgcgtattacttgaatgttgtcaaagaacta
aagcctgacgctgaacgtaaccaatttccgaagaatgaagaaggtgaacgcaaacaaaag
attgccaagctcgaaatcaaagatacccaagaggaagatatatataatattacgaaatct
gtttactgtttggattgtgatcagtcctattcgattgaagattcgccggaaaatattcaa
cgcttaattgaaaatgtattgaagtccaattcatctgctagagacgatgaaataaaggct
tgggaacaagaagtatttccgtgtgcacattcagtagacatagagcaatttcccaataac
tctgttgatttatctgtttgtgctcaatgtgatttgaaagaaaacttgtggatttgtttg
cattgtggaataattgggtgtggtagacaacagttcggttctgcgttgcaaggcaactcg
cacgctttgacacattatgaactttcagggcatccagttgccgttaaattaggttctcta
tcggctgacgatgtaaataattgtgattgttattgctaccaatgtcaggatgaagttaaa
gtgaacgatctttacgaaaaactattgaaatatggtattgatttagccaaatcggtgaaa
acggaaaagaatttaatcgagttgaatttagaccaaaatttgaattgggaatttaaactt
gacggtgccaatggtgaaaaattggaacccgtttttggtaaggatttaactggttttcaa
aatttgggtaattcatgttatttgaattctgtgttgcaagctctattcagtttaccaaat
tatcaacaatattttggcaaacaagaatttccgagctataaagaagtacaggacccatct
aaagatttactcagtcaattgattaaagttcatgatggattactttcaggaagatattca
agaccaaattctttgaaaggagatgattaccaattaggtatcaagccttccaccttcaaa
tcattgattggagaaaaccactcagaatttaagacccagaaacaacaagattcgtttgaa
tttttattgtatttgcttgataaaattgataatgaattagggttgaatttaaataggcca
atgaaattcttaatggggagcaaggtagtgtgttctaaatgtctacatggtaagattagt
atggaattaatagataatgtctctgttcccattgatgatgaaatagaaagcatcgaccaa
gaaaccggtaaaaagacttataaagaaacaaatatagtggatagttttaagaattactgc
gcagaagaagctgttgaagactttaaatgtgatagctgtgattcgccttcttccacggct
attaagtccactggattcaaaacatttcctgatgttcttgttgtaaacgcaagaagaatc
aagcttgaaaattgggttccagccaaagtggatgttccgatttcaattccaggatctatt
gacctatcacgttttacagcaccacaagcagcatctggagaaaccataagtagtgaaacc
gaaaacgagaacgattctaaagaatttattccaaatgaagagggtatgtcaatgttgtta
agtatgggctttcctgaagtgagatgtgtcaaaggattatataatactgggaataacaat
gctgaagatgccatgaattggattttagctcacatggatgatattgatattgatgaacct
ttcacgccgtctgatagcaatgtatcatcgactgatccatcacaagactcaattgataat
ttagtcgccatgggattttccaatcaattgtctaaaaagtcattaattcttaataaaaat
gacattaatgctgctgttgaatggctattttcgaatcctgatgacgatggtgtgattgaa
gattccaaaccaatcatcaatgtagctcaagagtgtaaagaacttacacaagatttactc
gacaatccgccatctaatgatggcagatatgatgcaaaggctgttatttgccacaagggt
tcttcaccccacactggtcattacgtcgtctacattagaaaactcatcaataatgaatca
aaatgggtattatttaatgatgagaaagttgttgcctgtgatgatgctagtatctctgat
attaaagagaccggttatatttatatttttgaaaagaagtaa

DBGET integrated database retrieval system