KEGG   Debaryomyces hansenii: DEHA2G10076gHelp
Entry
DEHA2G10076g      CDS       T01026                                 

Definition
DEHA2G10076p
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
dha  Debaryomyces hansenii
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    DEHA2G10076g
Enzymes [BR:dha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     DEHA2G10076g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:complement(847476..848483)
Genome map
AA seq 335 aa AA seqDB search
MTYSTITVIGSLNYDLVTYTKAVPEGGETYQANSFENHIGGKGLNEAIATSRLSGKQSKC
HVRMIGNVGNDSFGKELKQALVNSGVDTKYVKTLEKQSSGVAVIIVEEESGENRILITAG
ANGELCPTKEEYETYFPKDVDGAQFVILQNEYPDTVKSIEWLKANRQKINIAYNPSPFKP
EFISQQFWSKIDFLIINEGEALSVASKLLTDEENAKFNKTIKLDKVEGFSDLADKLQEMI
NPDNVSTVIITMGSKGSIFTSRNAKSTFVKSHKVENVVDTTGAGDTFFGGVVSQLANGSS
IEKAVEFATKASSLVIQKKGAAESIPTLEEINKYI
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgacatatagtacgattacagtcattggatcattaaactatgatttagttacttacacc
aaagcagttccagaaggtggtgagacctaccaagcaaattctttcgagaatcatatcggt
ggtaagggacttaatgaagcaattgcaacttccaggttatcaggcaaacaatcaaaatgc
catgttcgtatgatcggtaatgtgggtaatgattcattcggaaaggaattaaagcaggca
ttggtgaattctggagttgatacgaaatatgttaaaactttggaaaagcaatcatctggg
gtagcggtaattattgtcgaagaagaaagtggagagaatagaatcttaattacggcaggt
gccaatggagaattgtgtccaactaaggaggaatatgaaacatacttcccaaaagacgtc
gatggagctcaatttgttatcttacagaatgaatatcctgatactgttaaatctattgaa
tggcttaaagcgaaccgtcaaaaaattaatattgcttataatccttctccatttaaacct
gagtttatcagtcagcaattctggtctaagattgactttctaattatcaacgagggagaa
gcattgagtgttgcatcaaaattactcacggacgaagaaaatgctaaattcaataaaact
atcaaactcgacaaagtagaagggttcagcgacttagcagataagttgcaagaaatgatt
aacccagacaatgtaagtacggtcataatcactatgggaagtaaggggtcaatctttaca
tccaggaatgctaaatctacatttgtcaaatcccataaagttgaaaatgtcgttgatact
acaggtgctggcgacacattttttggtggtgttgttctgcaattagcgaatgggtcaagt
attgagaaggccgttgaatttgcaactaaagcaagcagcttagttattcaaaaaaaagga
gcagcagaaagtattccaactttggaagaaatcaataaatacatatga

DBGET integrated database retrieval system