KEGG   Debaryomyces hansenii: DEHA2G10978gHelp
Entry
DEHA2G10978g      CDS       T01026                                 

Definition
DEHA2G10978p
Orthology
K00052  
3-isopropylmalate dehydrogenase [EC:1.1.1.85]
Organism
dha  Debaryomyces hansenii
Pathway
Valine, leucine and isoleucine biosynthesis
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    DEHA2G10978g
   01230 Biosynthesis of amino acids
    DEHA2G10978g
  Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    DEHA2G10978g
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    DEHA2G10978g
Enzymes [BR:dha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     DEHA2G10978g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:920454..921602
Genome map
AA seq 382 aa AA seqDB search
MSQPELKKSKVDISKTITVLPGDHVGEEVCNEAIKVLQAIEDATPYRNIKFNLQKHLIGG
AAIDATGTPLPDESLEAAKNSDAVLLGAVGGPKWGTGSVRPEQGLLKIRKELNLYANLRP
CNFASDSLLELSPLKSEIVKGTDFTVVRELVGGIYFGERQEQAESEDKQTAWDTEKYSTE
EVTRITRMAAFMALQHNPPLPIWSLDKANVLASSRLWRTTVDKVMSEEFPQLTIQHQLID
SAAMILVQSPTKLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNSAFGLYE
PCHGSAPDLTENKVNPVATILSVAMMLRLSLDCVPEAEALEKAVGQVLDSGIRTGDLRGS
SSTKEVGDAIAEAVKKVLNQSV
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaacctgaattaaaaaaatcaaaagttgatataagcaaaaccatcacagtttta
ccaggtgatcatgtcggtgaagaagtttgtaacgaggccatcaaagtcttacaagctatt
gaggatgctaccccatacagaaacattaagttcaatttgcaaaaacatttgataggtggt
gccgcaattgacgctactggtactccattaccagatgaatctttggaggctgcaaaaaat
tctgatgctgtcttattaggtgctgtcggtggcccaaaatggggtaccggttccgttaga
cctgagcaaggtttattaaaaattagaaaggaattgaacttatatgctaacttgagacca
tgtaactttgcgtccgatagcttattagaattgtctccattaaagtctgagattgtgaag
ggtactgattttactgttgttcgtgaattagttggtggtatctattttggagaaagacaa
gaacaagcagaatcagaagacaagcagactgcatgggatactgaaaagtattctactgaa
gaagtaactagaattactagaatggcagcatttatggcgttacaacataatccaccatta
ccaatctggtctttagataaggctaatgttttggcgtcttcaagattatggagaacaact
gttgataaagttatgtctgaagaatttccacaattaacaattcaacatcaattaattgac
tcggcggctatgattttggttcaatctccaactaagttaaatggtattattatcacttct
aatatgtttggtgatattatttctgatgaagcatctgttatccctgggtcattggggctc
ttaccttctgcttctttggcttcgttgccagatactaattccgcttttggtttgtatgaa
ccatgtcatggttcagctccagatttgacggaaaacaaagttaatcctgtcgctaccata
ttatccgtagcaatgatgttaaggttatctttggattgtgtaccagaagctgaagctttg
gaaaaggcagtcggtcaagtcttagattccggaataagaacaggagatttacgtggttca
agctccactaaagaagtcggtgatgcgatcgcggaagcagtcaagaaggtattgaatcaa
tcagtctag

DBGET integrated database retrieval system