KEGG   Debaryomyces hansenii: DEHA2G10978gHelp
Entry
DEHA2G10978g      CDS       T01026                                 

Definition
DEHA2G10978p
Orthology
K00052  
3-isopropylmalate dehydrogenase [EC:1.1.1.85]
Organism
dha  Debaryomyces hansenii
Pathway
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:dha01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:dha01230]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:dha00290]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:920454..921602
Genome map
AA seq 382 aa AA seqDB search
MSQPELKKSKVDISKTITVLPGDHVGEEVCNEAIKVLQAIEDATPYRNIKFNLQKHLIGG
AAIDATGTPLPDESLEAAKNSDAVLLGAVGGPKWGTGSVRPEQGLLKIRKELNLYANLRP
CNFASDSLLELSPLKSEIVKGTDFTVVRELVGGIYFGERQEQAESEDKQTAWDTEKYSTE
EVTRITRMAAFMALQHNPPLPIWSLDKANVLASSRLWRTTVDKVMSEEFPQLTIQHQLID
SAAMILVQSPTKLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNSAFGLYE
PCHGSAPDLTENKVNPVATILSVAMMLRLSLDCVPEAEALEKAVGQVLDSGIRTGDLRGS
SSTKEVGDAIAEAVKKVLNQSV
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaacctgaattaaaaaaatcaaaagttgatataagcaaaaccatcacagtttta
ccaggtgatcatgtcggtgaagaagtttgtaacgaggccatcaaagtcttacaagctatt
gaggatgctaccccatacagaaacattaagttcaatttgcaaaaacatttgataggtggt
gccgcaattgacgctactggtactccattaccagatgaatctttggaggctgcaaaaaat
tctgatgctgtcttattaggtgctgtcggtggcccaaaatggggtaccggttccgttaga
cctgagcaaggtttattaaaaattagaaaggaattgaacttatatgctaacttgagacca
tgtaactttgcgtccgatagcttattagaattgtctccattaaagtctgagattgtgaag
ggtactgattttactgttgttcgtgaattagttggtggtatctattttggagaaagacaa
gaacaagcagaatcagaagacaagcagactgcatgggatactgaaaagtattctactgaa
gaagtaactagaattactagaatggcagcatttatggcgttacaacataatccaccatta
ccaatctggtctttagataaggctaatgttttggcgtcttcaagattatggagaacaact
gttgataaagttatgtctgaagaatttccacaattaacaattcaacatcaattaattgac
tcggcggctatgattttggttcaatctccaactaagttaaatggtattattatcacttct
aatatgtttggtgatattatttctgatgaagcatctgttatccctgggtcattggggctc
ttaccttctgcttctttggcttcgttgccagatactaattccgcttttggtttgtatgaa
ccatgtcatggttcagctccagatttgacggaaaacaaagttaatcctgtcgctaccata
ttatccgtagcaatgatgttaaggttatctttggattgtgtaccagaagctgaagctttg
gaaaaggcagtcggtcaagtcttagattccggaataagaacaggagatttacgtggttca
agctccactaaagaagtcggtgatgcgatcgcggaagcagtcaagaaggtattgaatcaa
tcagtctag

DBGET integrated database retrieval system