KEGG   Debaryomyces hansenii: DEHA2G12166gHelp
Entry
DEHA2G12166g      CDS       T01026                                 

Definition
DEHA2G12166p
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
dha  Debaryomyces hansenii
Brite
Enzymes [BR:dha01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     DEHA2G12166g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:1003647..1005611
Genome map
AA seq 654 aa AA seqDB search
MDGNFRRMSGEKEPHRPQPTALGRFELIIKFVFRCAILPWLLWELGFRSYYKTVLGVFDM
IFKVLSLLIAPENGGLFNGISGDNGRYGVNSAGGVDIDGLFDDVLREGKVNVEKKSDTFI
SRINSRYRWVIDGIESQQIWQSTRENVEELYFIFEKADYVFDRYVKHSPFCVLNKLNPNG
KKSHYEYDGIPLSKFEGFGSYLSYKRLGTKTLTTTKPHLHPILSSTMTAIQKPVVAKREA
PKAEVNPTVSRSTQTETIKPTKERTVSVFSPPVFNFAANSFAQSVSNEYKHASPKRIKLD
NSRVQVPSIVKPKQDKPRPPAIVTKPRVINIEFPNKQKSGFKLLIRPKHEPSIKKQKQGI
EVLSTSNTKRITKSISVDDVEYVEKVKHAIKQVLPKPDYDDGSLGPVILRLAWHCCATYN
KFTGNGGSNGSTMRFVPEITDDGNSGLDIARSALEPIKQKFPDITYSDLWTLAGKISIQE
MGGPKIPWRCGRVDCIDDRYVPPNGRLPFAYKNANHIRETFGRMGFNDRETVSLLGAHGL
GRCHKRFSGWEGKWTENPTSFSNDFYKVLLDEEWSLGTVPETGKEQYYNKDKSLIMLNTD
IELIRDPHFLHFVKLYSQHQATFFQDFANAFGKLLELGIERDSNGNVLPKNEFY
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atggacggtaattttaggagaatgtctggtgaaaaagaaccacataggccacagccgacg
gcccttgggcgcttcgaattgattatcaagtttgtatttagatgtgctattttgccatgg
ttgctatgggaattggggtttcggtcttattataagactgttcttggagtatttgatatg
atattcaaggtattactgttattgattgctccggaaaatggtggattgtttaatggaatc
agtggggataatgggcggtacggtgtaaatagtgccggtggggttgacatagatggattg
tttgacgacgttctcagggaaggaaaagttaatgtagaaaagaagtctgatacatttatt
ctgaggatcaattccaggtaccggtgggtgatagacgggattgaaagccagcaaatatgg
cagtcgacccgggaaaatgtagaagaattatactttatattcgagaaagcggattacgta
ttcgatagatatgtcaaacactcgccgttttgtgtcttgaacaagttgaaccccaatgga
aagaagtcccactatgaatatgacggcattcccttaagtaagttcgagggctttgggagc
taccttctgtacaaacgcttaggaactaaaaccctcacaaccacaaagccgcatttacat
ccaatactttcttctacaatgactgcaatacagaaaccagtggtagcaaaacgcgaagct
ccaaaagcagaagtaaatcccaccgtatccagactgacccaaactgaaactatcaagccc
actaaggaaaggactgtgagcgtttttagtcccccggtgtttaattttgcagctaactct
tttgctcagtcggtatccaacgaatacaagcatgcaagtcccaaacgtatcaaattagat
aattcaagagttcaagtccccagtatagtcaagccgaagcaagacaaaccgagaccgcct
gcaatcgtcaccaagcctcgggtcattaatattgaatttccaaacaaacagaagtctgga
tttaaacttttaattaggcctaaacatgaaccgagtattaaaaagcagaagcaaggtatt
gaggtcttatccacctcaaacaccaagagaatcacgaaatctatatcagttgatgatgta
gaatacgtagagaaagttaagcatgcaatcaaacaagtattacccaagcccgattatgac
gatgggtccttgggtcctgtaattttgcgactcgcatggcattgttgcgctacttacaat
aaattcactggtaatggtggttcgaatggttcaactatgagatttgttcctgaaattact
gatgatggcaactctggtcttgacattgcacgttctgcactcgaacctataaaacaaaaa
ttccctgatatcacctactcggatttatggactctagctggtaaaatttctattcaagaa
atggggggtccgaagataccatggagatgcggtagagttgattgcattgacgatagatat
gtcccacccaacggcaggttaccattcgcatacaaaaatgccaaccatattcgggaaaca
ttcggtagaatggggttcaatgatagagaaaccgtcctgttattgggtgcacatggtttg
ggaagatgtcacaagaggttcagcggatgggaaggaaaatggaccgaaaaccccacttcg
ttctctaacgacttctataaggtgttgttagatgaagaatggagtctaggaacggtgccg
gaaaccggaaaagagcagtattataacaaagacaaatccctaatcatgctaaataccgac
attgagctaattagagatcctcacttcctacattttgttaagctatatagtcaacaccaa
gcgacattctttcaagattttgccaacgcctttggaaagctcttagagttgggtatagaa
agagattccaacggtaacgtcttacccaagaatgagttctattga

DBGET integrated database retrieval system