KEGG   Debaryomyces hansenii: DEHA2G12342gHelp
Entry
DEHA2G12342g      CDS       T01026                                 

Definition
DEHA2G12342p
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
dha  Debaryomyces hansenii
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DEHA2G12342g
  Carbohydrate metabolism
   00640 Propanoate metabolism
    DEHA2G12342g
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DEHA2G12342g
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DEHA2G12342g
Enzymes [BR:dha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     DEHA2G12342g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:complement(1017683..1019200)
Genome map
AA seq 505 aa AA seqDB search
MLKANLKKVISNNKFNTQLTKMTSNYSTGSNIIGYAEDDVLFSNKNMARLVTLNRPKKLN
SLNTSMVSKIMPRLLEYSKSSVNNVIILNSTLAKGLCAGGDVTECAKQIKAGNAAYASDF
FQREYNLNYLISTYPKPYVALMDGITMGGGVGLSVHAPFRVSTERTKLAMPETDIGLFPD
VGTTFFLPRLDDKIGYYLALTGQVLSGLDCYMLGFATHYVPSDRIDSLVNRLSNLQPPSV
NDNKPEDNHASILNNNKEYYAQVNQAIEEFTENKLPEDYKYPFTTEQLKLIKNAFSQPSI
EEVLSYLEKDGSEFAQKTYKTLLLKSPTSLKVAFELLNRGAENSIRQQFELEMITATNLV
NIKPEENDFVKGVSHKLIDKIKEPAYPEWNSNKQPSGISSEFVQKALSKSIHSTKLNEPL
IEKLFGINYKSYPYNMGLPNGNQVKSYITGNDGSGRSYLPTPTEVTKYFKQSTSNKLGVE
LKVQSILDHHGEASKYDNKYVSWIE
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagctaatttgaaaaaggtaatttcaaataataaatttaatactcaattaact
aagatgacatctaactattcaactggttccaatattattggatatgcggaggatgatgtt
ttattttcgaacaaaaacatggccagacttgtgacgttgaacagacctaaaaaattgaat
tcattgaacacttcgatggtaagcaagattatgcctagattattggaatattcgaagtcg
agtgtgaacaatgtgattattttgaactcgacgttggcgaaaggcttgtgtgctggggga
gatgtgacagaatgtgccaaacagatcaaggcgggcaatgcagcgtatgcgtctgatttc
ttccaacgggaatacaatttgaattacttgatatcgacgtatcctaagccgtatgtggcg
ttgatggacggaattacgatggggggaggagtaggattgtcagttcacgcacctttccga
gtttccaccgagaggactaagttggcgatgccagagaccgatattgggttgttcccggat
gtggggactacttttttcttgccaagattggatgataaaattggttactatcttgcgttg
accggacaggtgttgagtggtttagactgctatatgttgggttttgctactcattacgtt
ccatctgacagaattgattcattagtcaacagattgtccaacttgcaacctccaagcgtg
aatgacaacaagcctgaagacaaccacgcatccatattgaataacaacaaggaatattac
gcgcaagtgaaccaggctattgaagaatttaccgaaaacaagttgccagaagactataaa
tacccatttaccactgaacaattaaaattaatcaagaatgcattttctcaaccttcaatt
gaagaggtattgagttacttggaaaaagatggttccgaatttgctcaaaagacttataag
actttattattgaaatcgccaacctccttaaaagtcgcctttgagttattgaaccgtggt
gccgaaaactctattcgccaacaatttgaattggaaatgattactgctaccaatttggtc
aatattaagcctgaagaaaatgattttgtcaagggtgtttctcacaagttgatcgacaag
attaaggaaccagcatacccggaatggaatctgaataaacaaccaagtggtatttcttct
gaatttgttcagaaggcgctcagcaaatcaattcattctactaaattgaacgaaccatta
attgaaaagttattcggtattaactataaatcttatccttataacatgggtttgccaaat
ggtaaccaagttaaaagttacataactggtaatgatggatctggtagatcgtacttacca
actccaactgaagtaacaaagtacttcaagcaatccacaagtaataagttaggagtcgaa
ttgaaagttcaatccattttagatcatcatggtgaagcgtcaaaatatgataacaaatac
gtctcttggatagaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system