KEGG   Debaryomyces hansenii: DEHA2G12342gHelp
Entry
DEHA2G12342g      CDS       T01026                                 

Definition
DEHA2G12342p
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
dha  Debaryomyces hansenii
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dha01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dha00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:dha00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:dha00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:complement(1017683..1019200)
Genome map
AA seq 505 aa AA seqDB search
MLKANLKKVISNNKFNTQLTKMTSNYSTGSNIIGYAEDDVLFSNKNMARLVTLNRPKKLN
SLNTSMVSKIMPRLLEYSKSSVNNVIILNSTLAKGLCAGGDVTECAKQIKAGNAAYASDF
FQREYNLNYLISTYPKPYVALMDGITMGGGVGLSVHAPFRVSTERTKLAMPETDIGLFPD
VGTTFFLPRLDDKIGYYLALTGQVLSGLDCYMLGFATHYVPSDRIDSLVNRLSNLQPPSV
NDNKPEDNHASILNNNKEYYAQVNQAIEEFTENKLPEDYKYPFTTEQLKLIKNAFSQPSI
EEVLSYLEKDGSEFAQKTYKTLLLKSPTSLKVAFELLNRGAENSIRQQFELEMITATNLV
NIKPEENDFVKGVSHKLIDKIKEPAYPEWNSNKQPSGISSEFVQKALSKSIHSTKLNEPL
IEKLFGINYKSYPYNMGLPNGNQVKSYITGNDGSGRSYLPTPTEVTKYFKQSTSNKLGVE
LKVQSILDHHGEASKYDNKYVSWIE
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagctaatttgaaaaaggtaatttcaaataataaatttaatactcaattaact
aagatgacatctaactattcaactggttccaatattattggatatgcggaggatgatgtt
ttattttcgaacaaaaacatggccagacttgtgacgttgaacagacctaaaaaattgaat
tcattgaacacttcgatggtaagcaagattatgcctagattattggaatattcgaagtcg
agtgtgaacaatgtgattattttgaactcgacgttggcgaaaggcttgtgtgctggggga
gatgtgacagaatgtgccaaacagatcaaggcgggcaatgcagcgtatgcgtctgatttc
ttccaacgggaatacaatttgaattacttgatatcgacgtatcctaagccgtatgtggcg
ttgatggacggaattacgatggggggaggagtaggattgtcagttcacgcacctttccga
gtttccaccgagaggactaagttggcgatgccagagaccgatattgggttgttcccggat
gtggggactacttttttcttgccaagattggatgataaaattggttactatcttgcgttg
accggacaggtgttgagtggtttagactgctatatgttgggttttgctactcattacgtt
ccatctgacagaattgattcattagtcaacagattgtccaacttgcaacctccaagcgtg
aatgacaacaagcctgaagacaaccacgcatccatattgaataacaacaaggaatattac
gcgcaagtgaaccaggctattgaagaatttaccgaaaacaagttgccagaagactataaa
tacccatttaccactgaacaattaaaattaatcaagaatgcattttctcaaccttcaatt
gaagaggtattgagttacttggaaaaagatggttccgaatttgctcaaaagacttataag
actttattattgaaatcgccaacctccttaaaagtcgcctttgagttattgaaccgtggt
gccgaaaactctattcgccaacaatttgaattggaaatgattactgctaccaatttggtc
aatattaagcctgaagaaaatgattttgtcaagggtgtttctcacaagttgatcgacaag
attaaggaaccagcatacccggaatggaatctgaataaacaaccaagtggtatttcttct
gaatttgttcagaaggcgctcagcaaatcaattcattctactaaattgaacgaaccatta
attgaaaagttattcggtattaactataaatcttatccttataacatgggtttgccaaat
ggtaaccaagttaaaagttacataactggtaatgatggatctggtagatcgtacttacca
actccaactgaagtaacaaagtacttcaagcaatccacaagtaataagttaggagtcgaa
ttgaaagttcaatccattttagatcatcatggtgaagcgtcaaaatatgataacaaatac
gtctcttggatagaataa

DBGET integrated database retrieval system