KEGG   Debaryomyces hansenii: DEHA2G14058gHelp
Entry
DEHA2G14058g      CDS       T01026                                 

Definition
(RefSeq) DEHA2G14058p
  KO
K01689  
enolase [EC:4.2.1.11]
Organism
dha  Debaryomyces hansenii
Pathway
Glycolysis / Gluconeogenesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DEHA2G14058g
  Energy metabolism
   00680 Methane metabolism
    DEHA2G14058g
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    DEHA2G14058g
Enzymes [BR:dha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     DEHA2G14058g
Messenger RNA biogenesis [BR:dha03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     DEHA2G14058g
Exosome [BR:dha04147]
 Exosomal proteins
  Proteins found in most exosomes
   DEHA2G14058g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
G:1167494..1168813
Genome map
AA seq 439 aa AA seqDB search
MAVTKLFARYVYDSRGNPTVEVDLTTDKGLFRSIVPSGASTGIHEALELRDGDKSKWLGK
GVTKAVANVNELIAPAFVKANLDVTNQSAVDDFLNKLDGTPNKSKLGANAILGVSLATAK
AAAAEKNVPLYQHLADISGSKQDKFVLPVPFQNVLNGGSHAGGALAFQEFMIVPTDAPTF
SEALRMGSEVYHNLKSLTKKKYGQSAGNVGDEGGVAPDIGSPREALDLIMDAIDKAGYKG
KIGIALDVAASEFYKDGKYDLDFKNPNSDESKWLSGEQLASLYEELINEYPIVSIEDPFG
EDDWDAWVHFYSKVSSKVQIVGDDLTVTNPLRIKTAIEKKAANALLLKVNQIGSLTESIK
AAQDSFDATWGVMVSHRSGETEDTFIADLSVGLRAGQIKTGAPARSERLAKLNQILRIEE
ELGDKAIYAGKNFHAASQL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcactaagttatttgctcgttatgtctacgattctcgtggtaacccaactgtt
gaagttgatttaaccaccgacaagggattattcagatccattgttccatctggtgcttcc
actggtatccatgaagctttggaattgagagatggtgacaagtccaaatggttaggtaag
ggtgttaccaaggctgttgccaatgttaacgaactcattgctccagctttcgtcaaggcc
aacctcgacgtcaccaaccaaagtgccgttgatgacttcttgaacaagttggacggtacc
ccaaacaagtctaagttaggtgccaatgccatcttaggtgtttctttagccactgctaag
gctgctgctgctgaaaagaacgttccattataccagcacttagctgatatttctggttcc
aagcaagacaagtttgtcttaccagttccattccaaaacgtcttgaacggtggttcccat
gctggtggtgctttagctttccaagaattcatgattgtcccaactgacgctccaaccttc
tctgaagctttgagaatgggttctgaagtctaccacaacttgaagtccttgaccaagaag
aagtacggtcaatccgctggtaacgtcggtgatgaaggtggtgttgctccagatatcggt
tctccaagagaagctttagacttgatcatggatgctattgacaaggctggttacaagggt
aagatcggtattgccttagatgttgccgcttctgaattctacaaagacggtaagtacgat
ttagacttcaagaatccaaactctgacgaatctaagtggttatctggtgaacaattagct
tccttatacgaagaattgatcaacgaatacccaattgtttctattgaagatcctttcggt
gaagatgactgggatgcttgggttcacttctactccaaggtttcttccaaggtccaaatc
gttggtgatgacttaactgtcactaacccattaagaatcaagaccgccattgaaaagaag
gccgccaacgctttgttattaaaggtcaaccaaattggttctttaactgaatccatcaag
gctgctcaagactcctttgatgctacctggggtgttatggtttcccacagatctggtgaa
accgaagataccttcattgctgatttatctgttggtttaagagctggtcaaattaagact
ggtgccccagccagatctgaaagattagccaagttaaaccaaatcttaagaatcgaagaa
gaattaggtgacaaggctatctacgctggtaagaacttccacgctgcttctcaattataa

DBGET integrated database retrieval system