KEGG   Debaryomyces hansenii: DEHA2G14784gHelp
Entry
DEHA2G14784g      CDS       T01026                                 

Definition
DEHA2G14784p
Orthology
K05759  
profilin
Organism
dha  Debaryomyces hansenii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:1212223..1212603
Genome map
AA seq 126 aa AA seqDB search
MSWQAYTDNLVSSGKIDKAALYSRAGDSLWAQSSNFQLDPKEITGIAKGYDDPSDLQAHG
LHVQGQKYMLLRADDRSIYGRLDAEGVVAVRTKQAILIAHYPAGVVAGEATTVVEKLADY
LISVNY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcaagcatacaccgataacttagtttcctccggtaaaattgataaagcagcg
ttatattcgagagcaggggactcattgtgggctcaatcatcgaacttccaattggatcct
aaagaaatcactggcattgcgaagggatacgatgatccatcagacttacaagcccatggt
ttacatgtccagggccaaaagtacatgcttttgagagccgatgacagatctatctatggt
agacttgatgccgagggagttgttgcagtcagaaccaaacaagctatcttgatagcccat
tacccagccggagttgttgcaggtgaagcaaccactgttgttgaaaaattggcagactat
ttaattagtgtcaattattaa

DBGET integrated database retrieval system