KEGG   Debaryomyces hansenii: DEHA2G15312gHelp
Entry
DEHA2G15312g      CDS       T01026                                 

Definition
DEHA2G15312p
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
dha  Debaryomyces hansenii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:1260436..1261161
Genome map
AA seq 241 aa AA seqDB search
MVDSKRVIPLESNPSIFNSLSKKLGLSPVLQFHDVYSLTDSELLAFLPQPVYAIILLFPL
TKNYEQYRKSSDKEQSKYNNEKFNDVKWFKQTIGNGCGLYALLHILANLPDDFIIDNSIL
KKCLLSQLSKSLSVKETANLVEQLEKNIQLDSNYGTQGQTEAPDASESIDLHFITFVKGK
DNHLYELDGRRAGPIDLGISTSSNHILDDSKLTEKIQFYMDNTDDENKHNFAMMAMGPSL
D
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggtagattcaaaaagagtgattccattggagtctaatccaagtatatttaattcttta
tcgaagaagttgggcttatcacctgtgcttcaatttcatgacgtttattccttaacagat
agtgagctattagcatttcttcctcaaccggtatatgcaataattttgttattcccatta
accaagaattatgaacaatatagaaagagctcagataaagaacaatcaaaatataataat
gaaaaatttaatgatgttaagtggttcaagcaaactataggcaatgggtgcggactttat
gctttgcttcatattttggctaatttaccagatgactttattattgataacctgatttta
aaaaagtgtttgttgtctcagttgagcaagagtttgtccgtaaaggaaactgcaaaccta
gttgagcaattagaaaaaaatatccagttggactctaattacggtacgcagggccaaaca
gaagctcccgatgcaagtgaatcaatagacttgcacttcattacttttgttaaaggaaaa
gataatcatttatatgaacttgatggaagaagagctggcccgattgacttaggtatatca
actagcctgaaccatattctagatgattctaaattaactgaaaagatccaattctacatg
gataatactgatgacgagaataaacataattttgcaatgatggctatgggtccctccctt
gattag

DBGET integrated database retrieval system