KEGG   Debaryomyces hansenii: DEHA2G15598gHelp
Entry
DEHA2G15598g      CDS       T01026                                 

Definition
DEHA2G15598p
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
dha  Debaryomyces hansenii
Brite
Enzymes [BR:dha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     DEHA2G15598g
Peptidases [BR:dha01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   DEHA2G15598g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:1289832..1293632
Genome map
AA seq 1266 aa AA seqDB search
MSEEGNKSPSMRGDYTFGAEEEEEVEIQQKFDESDANDLQQRREVLSQLLQTTNVHEGDT
LFLVSRDYVDDILNLPADTFEELKNNLGPINCKSLVDGAGFLYPDDEKSDAIATRSITQE
AFQKLIEWFGIHGEPIARAAMLNPATGNIEVERFPPYFHIHTLLKGNSNRSFHGQMHNGV
YLSRTRTFNDLFDAIRVIMFKTSGNQKPTPFRIWFIPADSTDNLPSSISLFAFINDIRKK
HLLRQDFYNYSLKSQGIVLPSYHILVESFDKSSKSYPVDNYFNSVDLSTFEIEKMIESGG
NLGLANLGNTCYMNSALQCLLHVPEINYYFFYNIFEKELNKTNPLGNKGQIAVAFGSLLH
KLFDNLKNTNSSFVSPREFKFTIGHYSSMFHGYQQQDSQEFLSWLLDALHEDLNRIYNKP
YCEKPELKDDEVSDPSAIARLADTCWQQHKQRNDSVIVDLFTGLYQSTLICPDCSKTSIT
FDPFNDLTLPLPINKKWYHTFTIINLSTDSLNLESHIMKLEVELDKTSNFDELLRYLSTF
LKVPQKYLFLFEIFNNFFYKDFQAKYNKLKFFPTSEIISDSDDILVYIIPHNPETDIIVP
VINTVSDQDKSYNISNPFGLPLFIVLDKINDVRSFGNIRKNLESTVKILSNIDIDDHCDE
MKKSNKKYHSAKDFPLLEKGSQEDVDMLEEDTNENINGPSQDEYDSDISLGNPNVGADYG
FNIRHYRESKPVTRSLNKFNYSSDDQDASSNGVLNIPNLRPNFNNLPSLSDELPQLKQKY
YHYPRYIEDSTNGNEQEASSDDKEKVDEDYVVVENKSDNEIEDNLAKDTPPESSDEGLDT
ENENNGSENIGSLFDSVSELPSQKNASTHYSESKTDNHPVLVYNNTTLVCEWDYDIFSKL
FEDPADQKWIDLPYIPNDQLEANKRKLEQQQKSTVSLYDCLRSFSTPEILGDQDLWYCPN
CKDHKQATKTIQIWSTGDLLTIHLKRFQSARTFSDKINMVVDFPVEGLDMSSFVSKEKDN
SDLIYDLIAVDNHYGGLGGGHYTASVKNFRDNKWYYFNDGRVSEMNDPTECITGAAYLLF
YRKRKPASEFLGGDQLQTVIQQGRDNFNQNLKYLMDNLIKTKEQVDDFNQHDIALKSHEE
LKFAEENQDEKEEDEEEEEVENVAKTSESLISPCNGTISSAKKSRLPINEETSSGEFNEG
GDNFNRRKQRLISKNKNYNKSISIKPDNTMEYSSSNIASPLSSGSEDNIVSDNISLPNSD
ANLDDK
NT seq 3801 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaggaaggaaataagtctccctctatgcgtggtgattacacttttggagccgaa
gaagaagaagaagtggaaatccaacaaaaattcgacgaaagtgatgcaaatgatttgcag
caaagaagggaggtattgagccaattattacagactacaaacgtacacgaaggagataca
ttgtttcttgtatcgcgagactatgttgatgatatactaaatttgccagcggacacattt
gaggaattgaagaataatttgggacctatcaattgtaagctgctagtagatggagccggg
ttcttatatcctgatgatgaaaagtcagacgcaattgctacgcgtagcattacacaggag
gcatttcagaaattgatagaatggtttgggatccacggtgaacccatcgcgagagcagcc
atgctaaaccctgctaccggtaatatagaggttgaaagatttccaccatattttcacatt
catacgttgttgaaaggaaattctaatagatcctttcacggtcagatgcataatggtgtt
tacttgtcacgcactagaacattcaatgatttgtttgatgcgattagagtaattatgttc
aaaacttctggtaatcaaaagcctacgccatttcgtatttggtttataccggcagatagt
actgataacttaccaagttcgatttccttatttgcatttattaacgatattcgtaagaaa
cacttacttcgtcaagacttttacaattattcgttgaaaagccaaggaatagtactacca
agctaccatattttagtagaatcatttgataaatctagtaagagctatcctgtggacaat
tactttaattctgttgatttatccacttttgaaattgaaaagatgattgagtcaggtgga
aatcttggtctagcaaatctaggaaacacatgctatatgaactctgccctacaatgttta
cttcatgttcctgaaataaattattatttcttttataatatttttgagaaggagcttaat
aaaactaaccctcttggtaataaaggccagattgctgttgcctttggttctttgttacat
aaactatttgacaacttgaaaaatacgaacagttcttttgtatctcctagagaatttaag
ttcaccattggtcattattcgtcaatgtttcatggctatcaacaacaagattctcaagag
tttctaagctggttattagatgctctccacgaagatttgaatcgtatttacaataagccc
tattgtgaaaaaccggaattaaaagacgatgaagtaagtgatccaagtgccattgccaga
ttagcagacacttgctggcagcaacataagcaacgtaatgactcagtaatagttgattta
tttacaggtttataccagtccaccttaatctgccccgattgttccaaaacttcaataacc
ttcgatccgtttaatgatctaacattgccattgccaatcaataagaaatggtatcataca
tttacaatcattaatttatccaccgactcgttaaatcttgagtcgcacataatgaaatta
gaggtggagttagacaagacctccaattttgatgaattattgagatatctcagtaccttt
cttaaggtcccgcaaaagtatttatttttgtttgaaatttttaataatttcttttacaaa
gatttccaggcaaaatataacaaattgaagttcttccctacaagcgaaattatttcagat
agtgatgatatcctcgtctatatcataccccacaatcctgaaaccgatattattgttccc
gtcattaatacagtgagtgaccaagataagtcctataacatatcgaatccttttggattg
ccgttatttattgtattggataaaataaatgatgttagaagtttcggaaatattagaaag
aaccttgaaagtacggttaaaattttatctaatattgacattgatgatcattgtgatgaa
atgaagaaatctaataagaagtatcattcagcgaaggactttccattgttagagaagggt
ctgcaagaggatgtcgatatgcttgaggaagatactaacgaaaacattaatggtccttca
caagatgaatacgattcagatatttcattaggtaaccctaacgtaggagctgattatggg
ttcaatattaggcattatcgcgaatcaaaacctgttactcgttcattgaacaaattcaat
tacagttctgatgatcaggatgcttcttcgaatggtgtacttaatattccaaacttgaga
ccaaatttcaataatttgccgagcttatcagacgagcttccacaattgaagcagaaatat
tatcattaccctcgatatattgaagattcaactaatggaaatgaacaggaagccagttct
gacgataaagaaaaggttgatgaagattatgttgtagtagagaataagtctgataatgaa
attgaagacaatcttgcgaaggatactcctccggaactgctggacgaaggtcttgatacg
gaaaatgagaataatgggtcagaaaatatcgggctgttatttgattctgttagcgaatta
ccttcgcagaaaaatgcatctacgcattactctgagctgaagactgataatcatccggtt
ttagtttacaataataccactttggtttgtgaatgggattatgatattttctcgaaactt
tttgaagatccagcagatcagaaatggatagatttgccgtacattccaaatgatcagtta
gaagccaataaaaggaaattagagcaacaacagaaatcgactgtttcattatatgattgt
ttgcggagttttagtacgccagaaattttaggtgatcaggatttgtggtattgtccaaat
tgtaaggatcataaacaagctacgaagacaattcaaatctggtcaactggtgatttatta
accatacatttgaagaggttccaaagtgcgagaactttcagtgacaagattaatatggtc
gtcgatttcccagtcgaaggattagatatgtcatcttttgtatctaaggaaaaagataat
tcggatttaatttatgatttaattgctgttgataatcattatggtggacttggaggggga
cattatacagcttcagtcaaaaatttcagggataacaaatggtactattttaatgatgga
agggttagtgaaatgaatgatcctaccgaatgtattaccggtgctgcttatttgttgttt
tacagaaagagaaagccagcttcggaattcttaggaggcgatcaactacaaacagtgatc
caacagggaagggataattttaaccaaaacttgaaatatttgatggataatttgattaag
acaaaagaacaagttgacgacttcaatcaacatgatatagctttaaagtctcacgaagaa
ttgaagttcgcagaagaaaatcaggatgaaaaagaagaagacgaagaagaagaagaagta
gaaaatgtcgcaaagacttcggagtctttaatatcgccctgtaatggaactattctgtca
gccaagaagtccagattaccaataaacgaagagacatctagtggtgaatttaatgagggc
ggtgataacttcaatcgaagaaaacaaaggttgatatctaaaaataagaattataataaa
tcaattagtatcaaaccggataatacaatggaatattcttcatcaaatatagcatcgcca
ttaagttcaggttcggaagataacatagtcagtgataatattagcttgccaaactctgat
gcaaatttggatgataaataa

DBGET integrated database retrieval system