KEGG   Debaryomyces hansenii: DEHA2G17578gHelp
Entry
DEHA2G17578g      CDS       T01026                                 

Definition
DEHA2G17578p
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
dha  Debaryomyces hansenii
Brite
Enzymes [BR:dha01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     DEHA2G17578g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:1430726..1432768
Genome map
AA seq 680 aa AA seqDB search
MALDTLDYSVMVALALAILVYFGKDKIWPGDDGTSAGFVANVSAGGHSRDLIETLNKNNK
NCIIFYGSQTGTAEDYASKLSKELGSRFGLKSMTVDFADYDFDNFAEISEDVLCFFLMAT
YGEGEPTDNAIEFFNFLDNEADTLSTLRFSVFGLGNSTYEFYNAIGKKANERLQELGAER
FSAYGEGDDGLGTMDEDFLSWKDSVIDSLKNNLNFEEHEAVYQPSLNLIESVHSIDDAVV
SHGEPNSAYVSNSVDLSKGPFDHAHPFLSKVVKTQELFNSKTRSCVHAEFDLSGTNLRYS
TGDHLAIWPSNANENIEKFLEAFDLYDKTDNVFELKAADSTVAIPFHTPITYGAVVRHHL
EISGDVSRQFLLSIAQFAPDEETKKEALRLGNSKELFATEIHEKCYNMADALLKISDGKP
WNNVPFEFIVESVPHLQARYYSISSSSLSEKTAIHVTAVVESEKIGNQLVTGVVTNLLKN
IEIEQNNKTDKPTVTYDLKGPRNKFSNYKLPVHVRRSTFKLPSNPSTPIICIGPGTGIAP
FRGFIREKVSQIKINNATIGKIMLFYGCRSEDEDYLYKDEWPSYAQALGSQFEMNVAFSR
KDPKNKEYVQHKLLENAEQINSLLNDGAFIYVCGDASKMARDVQSTLTKIIAKGRNISDE
KSAELIRSFKTQNKFQEDVW
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atggctttagatactttagattattctgtaatggtagcgttggcgcttgccattttggta
tattttggaaaggataaaatctggcctggagacgatgggacgtcggccggttttgttgcc
aatgtatcagctggaggccattccagggatttgatagaaacattgaataaaaacaataag
aactgcattattttttacggaagtcaaacaggaaccgctgaagactacgcgtccaagttg
tctaaggaattaggctcgaggttcgggttaaagtcgatgacagtggactttgcggactac
gattttgataactttgcagaaattagtgaagatgtattgtgcttctttttgatggctact
tatggtgaaggagagccgaccgacaacgctattgagtttttcaatttcttagacaacgag
gcagatactctctcaacattacgattctccgtgttcggattaggtaactcaacgtacgag
ttttacaatgccataggtaagaaggccaacgaaaggttacaagagttaggagcagaaaga
ttcagtgcttacggagaaggagacgatggtttgggcaccatggatgaagatttcttgagt
tggaaagacctggtcattgactctttgaagaataatttaaattttgaagaacacgaagcc
gtctatcaaccaagtttgaatttgattgaatctgttcattcgatcgatgatgccgtagtt
tcacatggtgaacccaattccgcatatgtatctaattcggttgatttgtcaaagggtcca
tttgatcacgctcatccatttttatcgaaagtagtaaaaactcaagaattattcaattca
aagacaaggtcttgtgttcatgcagaatttgatttatccggaactaacttaagatattcg
acaggtgatcacttagccatctggccatcaaacgcaaatgaaaatattgaaaaattctta
gaagcatttgatttatatgataagacagataacgtttttgaacttaaggccgcagattca
acagttgcgattcctttccatactccgattacgtatggtgccgttgttagacatcactta
gaaatttctggtgacgtctctagacagttcttattatcaattgcgcagtttgcaccagat
gaagaaacaaagaaggaagctttaagattaggtaatagcaaagagttgtttgccacggag
attcatgaaaagtgttacaacatggcggacgctttattaaagatttcagatggaaaacca
tggaataatgttccctttgaatttatagtagaatccgttccacatttgcaagcacgttac
tattcgatttcttcgtcgtctttgtccgaaaaaactgctatacatgttacagcagtagtc
gaatctgagaaaatagggaatcaactagttacaggggtcgtcactaacttattaaagaat
atagaaattgaacaaaataataaaacagataaacccactgttacatacgatttgaaagga
ccgagaaacaaattttcgaactataagttgcctgtacatgttagaagatcaacatttaag
ttacctagcaacccatcaaccccaataatttgtattggacctggtactggtattgctcct
ttcagaggttttattagagaaaaagtttctcaaattaaaatcaataatgccaccatcggt
aaaataatgttgttttatggttgtaggagtgaagatgaagattacttatacaaagatgaa
tggccatcatatgcgcaagctttaggatcgcaatttgaaatgaatgttgctttttcaaga
aaggatcctaaaaacaaagagtatgttcaacacaagttattagagaacgctgaacagatt
aattcattattaaatgacggcgcttttatatatgtctgtggtgatgcatctaaaatggca
agagatgtacagagtacgttgactaagatcatagctaaaggaagaaatatttctgatgaa
aagtctgctgaattaattagatcgttcaagactcagaacaaatttcaagaagatgtatgg
tag

DBGET integrated database retrieval system