KEGG   Debaryomyces hansenii: DEHA2G19690gHelp
Entry
DEHA2G19690g      CDS       T01026                                 

Definition
DEHA2G19690p
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
dha  Debaryomyces hansenii
Brite
Enzymes [BR:dha01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     DEHA2G19690g
Peptidases [BR:dha01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   DEHA2G19690g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:complement(join(1600923..1601843,1601899..1601937))
Genome map
AA seq 319 aa AA seqDB search
MSESGWNTIDSDAGVFTELVDKLQIKNVQFDDLYSIDSDSLKSSSPLYGVIFLFKYGQVD
RDYAADNNKPIDGTYDEDYQQKGIFFANQTIQNACATQAVLNVLLNKSEIEIGEELTNFK
GFVEGFDSEICGETISNSELIRSVHNSFSSPSLMVDEDKQKPKPKYDDKNDGLFHFVGYL
NINDQIYELDGLKTYPIKHGECKSNEEFCQKLPEILMRRISKYGDELRFSLLAISNDKLR
QYQEIGDVAMMHSEMMKRETWKRENELRRHDFVGLMVELLKNIGKDLSDDEYEDIIKQAR
HKGQLKLLQNFTQNHVANN
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaagtggttggaatacaatagattccgatgcaggggttttcacagaactagtt
gataagttgcagatcaagaatgttcaattcgatgatttatactctatagattccgattca
ttgaaaagttccagtcctttgtatggggttatctttttgtttaagtatgggcaggttgat
agagactatgcggccgataacaataagccaatagatggaacatacgatgaagattaccaa
cagaaagggatttttttcgctaatcaaactattcagaacgcatgtgctacacaagcagtg
ttgaacgtgttgttgaacaagtcagagatcgaaataggagaggagcttacaaactttaag
ggtttcgtggaaggttttgatagcgagatctgtggcgaaaccatttctaacagtgaactt
atcagatctgttcacaactctttttcatcgccatcgcttatggttgatgaggataagcaa
aaaccaaagcccaagtatgatgacaaaaatgatgggttgttccactttgttggatacttg
aatatcaacgaccaaatatacgaattggatggtttaaaaacgtatccaataaagcatggt
gagtgcaagtcaaacgaggagttttgtcaaaaattaccggagatcttaatgagacgtata
agtaaatatggtgatgagttacgtttttcgttgttggcaatttcgaacgacaaattgcgt
caatatcaagaaatcggcgatgttgccatgatgcattccgaaatgatgaaaagagaaaca
tggaaaagagaaaacgagttaagaagacatgattttgttggattaatggtagaattatta
aaaaatataggcaaggatttatctgacgatgaatatgaagatataataaagcaagctaga
cataaaggccaactaaaattactacaaaactttactcaaaaccatgttgctaataattga

DBGET integrated database retrieval system