KEGG   Debaryomyces hansenii: DEHA2G19756gHelp
Entry
DEHA2G19756g      CDS       T01026                                 

Definition
DEHA2G19756p
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
dha  Debaryomyces hansenii
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:dha04141]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:1603851..1604780
Genome map
AA seq 309 aa AA seqDB search
MYLWKYCLILVHVIVAIAARAQGDLYKSDDNIYELSPSNFDKVIQKTNYTSLVKFYAPWC
GYCKQLEPAYHKLAKLIHNDGQYAINVASVNCDEDKNKELCAKYKISGFPTLMVFRPPKY
DSKKKNKVYSHAVEPYKGERSLKSMYAFVTSRIKNYVKKFANLQSDGLKDWLMENKENNK
VLLLTESKQISPLYKSLAIDFINTLKFGMVNIKSLKDVNNIKIEINDKKIALPIGQDDKL
PILLNFDEKTQEFSRFESEKLTDKVKLSEWLIESNNVQPLEGPLSKKDKKYYSNYRKGIK
GKKVVHDEL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgtatttatggaaatactgcttgatattggttcatgtgatagtagctatagctgcaaga
gcccagggggatttatacaaatcagatgacaatatatatgagttatcaccatcgaatttt
gacaaggttattcagaagacaaattatacatctctagtcaaattttacgctccttggtgt
ggatattgtaaacaattagaacctgcttatcataaattggccaagttaatacataatgat
ggtcagtatgctataaatgttgctagtgttaattgcgatgaagataaaaataaggaactt
tgtgccaaatataaaatcagtggctttcctacattgatggtatttagaccaccaaagtat
gattcaaagaagaagaataaagtatacagccatgcagttgagccatacaaaggggaaaga
tcgttgaaatcaatgtatgcattcgtaacgtctagaatcaagaattatgtcaaaaaattt
gcaaacttacaatcagacggattaaaggactggttaatggagaataaagagaacaacaag
gttttactcttaacagaatcaaaacagattagtcccttatacaaatccttagccattgat
ttcattaatacattgaaattcggaatggttaacataaaatcacttaaggatgtaaataat
attaaaattgaaataaatgataagaaaattgccttacccatcggtcaagatgataagtta
ccaattttgctcaattttgacgagaaaactcaggaattttccaggttcgaatctgaaaag
cttactgataaagtgaaattaagtgaatggcttatagaatctaataatgttcaaccttta
gagggcccattatcgaagaaagacaaaaagtattattccaattatagaaaaggtattaag
ggcaagaaagtagttcatgatgaattataa

DBGET integrated database retrieval system