KEGG   Debaryomyces hansenii: DEHA2G19910gHelp
Entry
DEHA2G19910g      CDS       T01026                                 

Definition
DEHA2G19910p
Orthology
K01251  
adenosylhomocysteinase [EC:3.3.1.1]
Organism
dha  Debaryomyces hansenii
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:dha00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:1615011..1616360
Genome map
AA seq 449 aa AA seqDB search
MSAPASNYKVADISLAAFGRKDIELSENEMPGLMDIRKKYGSSQPLKGARVAGCLHMTIQ
TAVLIETLVALGAEVTWSSCNIFSTQDHAAAAIAAAGVPVFAWKGETDEEYEWCIEQQLF
AFKDGKKLNLILDDGGDLTTLVHKKYPEMLDDCYGLSEETTTGVHHLYKMLKEGTLKVPA
INVNDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGFGDVGKGCAMALRGMGA
RVIVTEIDPINALQAAVSGYQVAPLEEVASIGQIFVTTTGCRDIITGVHFEQMPEDAIVC
NIGHFDIEIDVAWLKANSESVVEIKPQVDRFLMKNGRHVILLAEGRLVNLGCATGHSSFV
MSCSFSNQVLAQIALFKAEDKEFLAKFPEFGKSDKFDIGVHLLPKVLDETVAKCHLDHLG
AKLTVLSDVQAEYLGIPKEGPFKADIYKY
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctccagcttccaattacaaagttgccgatatctccttagctgccttcggtaga
aaagatattgaattatctgaaaatgaaatgccaggtttaatggatatcagaaagaaatac
ggttcatctcaaccattaaagggtgctagagttgctggttgtttacacatgaccattcaa
actgctgttttgatcgaaaccttagttgctttaggagcagaagttacctggtcatcatgt
aacattttctctacccaagaccacgctgctgctgctattgctgctgctggtgttccagtt
ttcgcctggaagggagaaaccgacgaagaatacgaatggtgtattgaacaacaattattc
gctttcaaggacggtaagaaattgaacttgatcttggatgatggtggagacttgaccact
ttagtccacaagaagtacccagaaatgttagacgactgttacggtttatctgaagaaacc
accaccggtgtccaccacttatacaagatgttgaaggaaggtaccttaaaggttccagct
atcaacgttaacgactctgtcaccaagtctaagttcgataacttatacggttgtcgtgaa
tctttgatcgatggtattaagagagccaccgatgttatgattgccggtaaggttgccgtt
gtcgctggtttcggtgatgtcggtaagggttgtgccatggctttaagaggtatgggtgct
agagttattgttactgaaattgatccaattaacgctttacaagctgccgtttctggttac
caagttgctccattagaagaagttgcttctattggtcaaatcttcgtcaccaccactggt
tgtcgtgacattatcactggtgttcactttgaacaaatgccagaagatgctattgtctgt
aacattggtcacttcgatatcgaaatcgatgtcgcatggttaaaggccaactccgaatct
gttgttgaaatcaagccacaagtcgacagattcttgatgaagaacggtcgtcacgttatc
ttattagctgaaggtagattagttaacttaggttgtgccaccggtcactcatctttcgtc
atgtcttgttctttctccaaccaagttttggcccaaatcgctttattcaaggctgaagac
aaagaattcctcgccaagttcccagaattcggtaagtctgacaaattcgacatcggtgtc
cacttattaccaaaggttttggatgaaaccgttgctaagtgtcacttggaccacttaggt
gctaagttgaccgtcttatctgacgttcaagctgaatacttaggtattccaaaggaaggt
cctttcaaggctgatatttacaagtactag

DBGET integrated database retrieval system