KEGG   Debaryomyces hansenii: DEHA2G19910gHelp
Entry
DEHA2G19910g      CDS       T01026                                 

Definition
DEHA2G19910p
Orthology
K01251  
adenosylhomocysteinase [EC:3.3.1.1]
Organism
dha  Debaryomyces hansenii
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    DEHA2G19910g
Enzymes [BR:dha01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.1  Thioether and trialkylsulfonium hydrolases
    3.3.1.1  adenosylhomocysteinase
     DEHA2G19910g
Protein phosphatases and associated proteins [BR:dha01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     DEHA2G19910g
Exosome [BR:dha04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DEHA2G19910g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:1615011..1616360
Genome map
AA seq 449 aa AA seqDB search
MSAPASNYKVADISLAAFGRKDIELSENEMPGLMDIRKKYGSSQPLKGARVAGCLHMTIQ
TAVLIETLVALGAEVTWSSCNIFSTQDHAAAAIAAAGVPVFAWKGETDEEYEWCIEQQLF
AFKDGKKLNLILDDGGDLTTLVHKKYPEMLDDCYGLSEETTTGVHHLYKMLKEGTLKVPA
INVNDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGFGDVGKGCAMALRGMGA
RVIVTEIDPINALQAAVSGYQVAPLEEVASIGQIFVTTTGCRDIITGVHFEQMPEDAIVC
NIGHFDIEIDVAWLKANSESVVEIKPQVDRFLMKNGRHVILLAEGRLVNLGCATGHSSFV
MSCSFSNQVLAQIALFKAEDKEFLAKFPEFGKSDKFDIGVHLLPKVLDETVAKCHLDHLG
AKLTVLSDVQAEYLGIPKEGPFKADIYKY
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctccagcttccaattacaaagttgccgatatctccttagctgccttcggtaga
aaagatattgaattatctgaaaatgaaatgccaggtttaatggatatcagaaagaaatac
ggttcatctcaaccattaaagggtgctagagttgctggttgtttacacatgaccattcaa
actgctgttttgatcgaaaccttagttgctttaggagcagaagttacctggtcatcatgt
aacattttctctacccaagaccacgctgctgctgctattgctgctgctggtgttccagtt
ttcgcctggaagggagaaaccgacgaagaatacgaatggtgtattgaacaacaattattc
gctttcaaggacggtaagaaattgaacttgatcttggatgatggtggagacttgaccact
ttagtccacaagaagtacccagaaatgttagacgactgttacggtttatctgaagaaacc
accaccggtgtccaccacttatacaagatgttgaaggaaggtaccttaaaggttccagct
atcaacgttaacgactctgtcaccaagtctaagttcgataacttatacggttgtcgtgaa
tctttgatcgatggtattaagagagccaccgatgttatgattgccggtaaggttgccgtt
gtcgctggtttcggtgatgtcggtaagggttgtgccatggctttaagaggtatgggtgct
agagttattgttactgaaattgatccaattaacgctttacaagctgccgtttctggttac
caagttgctccattagaagaagttgcttctattggtcaaatcttcgtcaccaccactggt
tgtcgtgacattatcactggtgttcactttgaacaaatgccagaagatgctattgtctgt
aacattggtcacttcgatatcgaaatcgatgtcgcatggttaaaggccaactccgaatct
gttgttgaaatcaagccacaagtcgacagattcttgatgaagaacggtcgtcacgttatc
ttattagctgaaggtagattagttaacttaggttgtgccaccggtcactcatctttcgtc
atgtcttgttctttctccaaccaagttttggcccaaatcgctttattcaaggctgaagac
aaagaattcctcgccaagttcccagaattcggtaagtctgacaaattcgacatcggtgtc
cacttattaccaaaggttttggatgaaaccgttgctaagtgtcacttggaccacttaggt
gctaagttgaccgtcttatctgacgttcaagctgaatacttaggtattccaaaggaaggt
cctttcaaggctgatatttacaagtactag

DBGET integrated database retrieval system