KEGG   Debaryomyces hansenii: DEHA2G20306gHelp
Entry
DEHA2G20306g      CDS       T01026                                 

Definition
DEHA2G20306p
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
dha  Debaryomyces hansenii
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dha00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:complement(1646020..1646826)
Genome map
AA seq 268 aa AA seqDB search
MSGKNDEPAKSEPFNGTYSPKPILPLKRSRLAGDDTNPSFGTPLQTRVASPCTLNPPIDN
DGLSWPSRGARSRIEQTQEEANGREMRIASAVKTILTELGEDVDREGLLETPERYARAML
YFTKGYEDNIRDVIKRAVFEENHDEMVIVRDIEIYSLCEHHLVPFFGKAHIAYIPNKRVL
GLSKLARLAEMYARRFQVQERLTKQIAMALGEILKPRGVAVVIEATHMCMVSRGVQKTGS
STTTSCMLGCFRDQQKTREEFLTLLGRH
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtcagggaagaatgatgagccagcaaaaagtgaaccatttaatggtacttactcccca
aaaccgattttacccttgaaaagatcgagattagctggcgatgacactaacccgagcttt
ggcacacctttacaaaccagggttgcgtcaccatgtaccttaaaccctcctattgacaat
gatggattatcttggccatctagaggggctcgttctcgtatcgaacaaacacaggaagaa
gccaatggtagagaaatgaggatagcttctgccgttaagactatattgaccgagttagga
gaagacgttgatagagaaggattattggaaactccagaacgttatgcgcgtgcaatgtta
tactttacaaaagggtatgaagataatattagagatgttatcaagagagcagttttcgag
gaaaatcatgatgagatggttattgtaagagacattgagatatactcattatgcgagcat
cacttagttccgttctttggtaaggctcacattgcgtatattccgaataagagagtatta
ggattatccaaattggcccgtttggcagaaatgtatgccagaagattccaagttcaagaa
agattaacgaaacaaattgcgatggcattgggcgaaatcttaaaaccaaggggagtcgct
gttgttatagaagcaactcatatgtgtatggttagtagaggggtccaaaagactggttct
tcgactacaaccagttgtatgcttgggtgtttccgtgatcaacagaagacaagagaagaa
tttttgactttattaggtagacattaa

DBGET integrated database retrieval system