KEGG   Debaryomyces hansenii: DEHA2G20768gHelp
Entry
DEHA2G20768g      CDS       T01026                                 

Definition
DEHA2G20768p
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dha  Debaryomyces hansenii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DEHA2G20768g
   01230 Biosynthesis of amino acids
    DEHA2G20768g
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DEHA2G20768g
   00030 Pentose phosphate pathway
    DEHA2G20768g
   00051 Fructose and mannose metabolism
    DEHA2G20768g
   00052 Galactose metabolism
    DEHA2G20768g
  Energy metabolism
   00680 Methane metabolism
    DEHA2G20768g
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    DEHA2G20768g
Enzymes [BR:dha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     DEHA2G20768g
Protein phosphatases and associated proteins [BR:dha01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     DEHA2G20768g
Messenger RNA biogenesis [BR:dha03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     DEHA2G20768g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:1682141..1685122
Genome map
AA seq 993 aa AA seqDB search
MPIPRNDIEGISFISLITNKNEEFEESANFYNKLGFRLTKNFSKITNNSESKPKLQIGIS
NDSLKELWLESFPLQNTDENGFIRPWQELSVYDGDGCEKLNSATTLKIRLSTLDDLSNTA
KELNFFTTDLPKVKDILTKDLNTEFESPSDTVIKVVDPMGNTLNFSNFENPLSEKSFDSP
EDYLKYKTEKLLSSLDRLEHKSVEDQPTEKTKKKKKKIAIMTSGGDAPGMNSAVRAVVRA
GIYYGCDVFAIYEGYEGLVQGGDLMRKMEWADVRSYLSLGGTAIGTARCAKFRERPGRLQ
GAHNMVENGIDALIVCGGDGSLTGADLFRSEWPSLVEELVSNGTFTTKEVEPYRHLTMVG
LVGSIDNDMASTDSTIGAYSALERITEMVDYIDATASSHSRAFIVEVMGRHCGWLGLMSG
LATGADFIFIPERPPKAGQWQNELKDVCSRHRQKGKRNTTVIIAEGAIDDDLNPITPDEV
QKVLVALGLDTRITTLGHVQRGGTAVAYDRLLATLQGVDAVKAVLELTPDDPSPMIGSLE
NKIVRKPLIEAVKLTKSVATAIENKDFDKAMSLRDSSFEDAYHHFLSSSIYDDGSKILPE
AERLNIGVVHVGASSSGLNAATRAAALYCMSKGHKLFAIQNGFSGLINEGEIKELSWLDV
EGWHNKGGSEIGTNRSLPSEDFGNVAYYFQKFKLQGLIIIGGFESFSALNELDEKKQEYP
IFNIPMVVIPATVSNNVPGTEYSLGGDTCMNQLLKYCDAVKQSASSSRRRVFVVEVQGGY
SGFVASYCGLITGSLATYTPESKIDLKTIQEDIDLLYEVFEDDRGEYNNGKMIIRNEQAS
SVYTTDLIADIIKESAGGRFETRTAVPGHVQQGFTPTSMDRVNACRFAVKSCQYIEDWNT
KLGGLISDMDATKTNRRSRSNVKNSIEHILEEKNGSAVVLGIQGAQIKFNSVEALFAKDA
NIPLRKGRVVHWTEMIEVADMLSGRLLLREKKQ
NT seq 2982 nt NT seq  +upstreamnt  +downstreamnt
atgcctattccgaggaatgatatcgaaggaattagttttatttcgttaattacgaataag
aatgaagaattcgaagaaagtgctaatttctataataaattaggatttagattaaccaag
aatttttctaaaataacgaacaactcagaaagtaagccaaaattgcagatagggatttcg
aatgattccttaaaggaactttggttggagtcttttccattgcaaaatacagacgaaaat
ggcttcattagaccttggcaagagttgctggtgtatgatggggatggatgtgaaaaatta
aactcggcgactactcttaagattagattgtctactttggatgacttaagcaatactgct
aaagaattgaatttttttacgactgatttaccaaaggtcaaggatattttgacgaaggat
ttgaacaccgaatttgaaagtccaagcgacaccgtaatcaaagtcgttgatccaatgggg
aataccttaaatttttcgaacttcgaaaacccgttgtccgaaaagtcattcgattctcca
gaagactatttgaagtataaaacggaaaaattactttcatcattagatcgtttggaacat
aagagtgtcgaagatcaaccaactgagaagactaaaaagaaaaagaaaaagattgctatt
atgacttctggaggtgatgcgccaggtatgaattcagcagttcgtgcagttgtaagagct
ggtatttattatggatgcgacgtgtttgctatttatgaaggttacgaaggattagtccaa
ggtggtgatttgatgcgtaaaatggaatgggccgatgttagatcgtacttatcattaggt
ggtactgctattggtactgcgagatgtgctaaatttcgtgaacgtccgggtagattacaa
ggtgctcataatatggttgaaaacggtatcgatgcgttgattgtttgtggtggtgacggt
tcattgaccggagctgacttatttagatccgaatggccttcattagtagaagaattggtt
agtaacggtacttttaccacaaaagaagtagagccatatagacatttaacaatggttgga
ttagttggctcaatcgataacgatatggcttcaacagactctactattggtgcatattca
gcattggagagaattaccgagatggttgattacattgatgctacagcttcttctcattcg
agagcttttattgttgaagttatgggtagacattgtgggtggttaggtttgatgtcgggt
cttgcgactggggctgactttattttcattcctgaaagaccaccaaaggcaggccaatgg
caaaacgaattaaaagatgtttgctcgagacatagacaaaaaggtaaaagaaacactact
gttattattgcagagggggcaattgatgatgatttaaacccgattacccctgatgaggtt
caaaaagttcttgttgcattaggtttagataccagaattactaccttaggccacgttcaa
agaggtggtacagccgtagcatatgaccgtttgttagcaacattacagggtgttgatgct
gttaaagctgtattggaattaactcctgatgacccttcacctatgatcggtagtttagaa
aacaagatcgtcagaaagcctttaatcgaagcagttaaattaactaagtctgtcgcgact
gctattgaaaataaagatttcgataaagctatgagtttaagagactctagtttcgaggat
gcatatcatcacttcttatcgtcttcaatctatgatgatggcctgaaaatattaccagaa
gcagaaagattgaatatcggtgtcgttcatgttggggcttcatcctcgggtttgaatgcg
gcaaccagagctgcagccttatactgtatgtctaaaggtcataaattatttgctattcaa
aacggttttagtggattaatcaatgaaggtgaaataaaggaattaagttggttagatgtc
gaaggatggcataacaaaggtggttcggaaattggcactaataggtcattaccaagtgag
gattttggtaacgttgcatactatttccaaaagttcaagcttcaaggtttgataataatc
ggtggctttgaaagtttttcagctttaaatgaattggatgaaaaaaaacaagaatatcct
attttcaatattccgatggttgttatacctgcaaccgtgtctaataacgtgccgggtaca
gaatattcgttgggtggtgacacctgtatgaatcaattgcttaaatattgtgatgctgta
aagcaatcagcgtcttcatctagaagaagagtattcgtggttgaggttcaaggtggttat
tcagggtttgttgcctcatactgtggtttaatcactggatcacttgctacatatacccca
gaatccaaaatcgacttgaaaactatacaagaggacatagatcttttgtacgaggttttc
gaagatgacagaggtgaatataacaacgggaaaatgattatcagaaatgaacaagcttct
tctgtgtatactacagatctcattgccgacataattaaggaatctgccggtggaaggttt
gaaacaagaactgctgttccgggtcacgtccaacaggggtttactcctacgtccatggat
agagtaaatgcatgcagatttgccgtgaagtcgtgtcaatacatcgaagactggaacacg
aaattaggaggcttgattctggacatggatgccaccaaaacgaacagaagaagtcgttct
aatgtcaaaaacagtattgaacacattcttgaagagaaaaacggctctgctgttgtgctt
ggaatccagggtgcccaaatcaaattcaactctgtcgaagccttattcgctaaagacgct
aatattcccttgagaaagggcagagtggtccattggacagaaatgatcgaagtggccgat
atgttaagcggaagactcttattaagagaaaaaaagcaatga

DBGET integrated database retrieval system