KEGG   Debaryomyces hansenii: DEHA2G20768gHelp
Entry
DEHA2G20768g      CDS       T01026                                 

Definition
DEHA2G20768p
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dha  Debaryomyces hansenii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DEHA2G20768g
   01230 Biosynthesis of amino acids
    DEHA2G20768g
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DEHA2G20768g
   00030 Pentose phosphate pathway
    DEHA2G20768g
   00051 Fructose and mannose metabolism
    DEHA2G20768g
   00052 Galactose metabolism
    DEHA2G20768g
  Energy metabolism
   00680 Methane metabolism
    DEHA2G20768g
Enzymes [BR:dha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     DEHA2G20768g
Protein phosphatases and associated proteins [BR:dha01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     DEHA2G20768g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:1682141..1685122
Genome map
AA seq 993 aa AA seqDB search
MPIPRNDIEGISFISLITNKNEEFEESANFYNKLGFRLTKNFSKITNNSESKPKLQIGIS
NDSLKELWLESFPLQNTDENGFIRPWQELSVYDGDGCEKLNSATTLKIRLSTLDDLSNTA
KELNFFTTDLPKVKDILTKDLNTEFESPSDTVIKVVDPMGNTLNFSNFENPLSEKSFDSP
EDYLKYKTEKLLSSLDRLEHKSVEDQPTEKTKKKKKKIAIMTSGGDAPGMNSAVRAVVRA
GIYYGCDVFAIYEGYEGLVQGGDLMRKMEWADVRSYLSLGGTAIGTARCAKFRERPGRLQ
GAHNMVENGIDALIVCGGDGSLTGADLFRSEWPSLVEELVSNGTFTTKEVEPYRHLTMVG
LVGSIDNDMASTDSTIGAYSALERITEMVDYIDATASSHSRAFIVEVMGRHCGWLGLMSG
LATGADFIFIPERPPKAGQWQNELKDVCSRHRQKGKRNTTVIIAEGAIDDDLNPITPDEV
QKVLVALGLDTRITTLGHVQRGGTAVAYDRLLATLQGVDAVKAVLELTPDDPSPMIGSLE
NKIVRKPLIEAVKLTKSVATAIENKDFDKAMSLRDSSFEDAYHHFLSSSIYDDGSKILPE
AERLNIGVVHVGASSSGLNAATRAAALYCMSKGHKLFAIQNGFSGLINEGEIKELSWLDV
EGWHNKGGSEIGTNRSLPSEDFGNVAYYFQKFKLQGLIIIGGFESFSALNELDEKKQEYP
IFNIPMVVIPATVSNNVPGTEYSLGGDTCMNQLLKYCDAVKQSASSSRRRVFVVEVQGGY
SGFVASYCGLITGSLATYTPESKIDLKTIQEDIDLLYEVFEDDRGEYNNGKMIIRNEQAS
SVYTTDLIADIIKESAGGRFETRTAVPGHVQQGFTPTSMDRVNACRFAVKSCQYIEDWNT
KLGGLISDMDATKTNRRSRSNVKNSIEHILEEKNGSAVVLGIQGAQIKFNSVEALFAKDA
NIPLRKGRVVHWTEMIEVADMLSGRLLLREKKQ
NT seq 2982 nt NT seq  +upstreamnt  +downstreamnt
atgcctattccgaggaatgatatcgaaggaattagttttatttcgttaattacgaataag
aatgaagaattcgaagaaagtgctaatttctataataaattaggatttagattaaccaag
aatttttctaaaataacgaacaactcagaaagtaagccaaaattgcagatagggatttcg
aatgattccttaaaggaactttggttggagtcttttccattgcaaaatacagacgaaaat
ggcttcattagaccttggcaagagttgctggtgtatgatggggatggatgtgaaaaatta
aactcggcgactactcttaagattagattgtctactttggatgacttaagcaatactgct
aaagaattgaatttttttacgactgatttaccaaaggtcaaggatattttgacgaaggat
ttgaacaccgaatttgaaagtccaagcgacaccgtaatcaaagtcgttgatccaatgggg
aataccttaaatttttcgaacttcgaaaacccgttgtccgaaaagtcattcgattctcca
gaagactatttgaagtataaaacggaaaaattactttcatcattagatcgtttggaacat
aagagtgtcgaagatcaaccaactgagaagactaaaaagaaaaagaaaaagattgctatt
atgacttctggaggtgatgcgccaggtatgaattcagcagttcgtgcagttgtaagagct
ggtatttattatggatgcgacgtgtttgctatttatgaaggttacgaaggattagtccaa
ggtggtgatttgatgcgtaaaatggaatgggccgatgttagatcgtacttatcattaggt
ggtactgctattggtactgcgagatgtgctaaatttcgtgaacgtccgggtagattacaa
ggtgctcataatatggttgaaaacggtatcgatgcgttgattgtttgtggtggtgacggt
tcattgaccggagctgacttatttagatccgaatggccttcattagtagaagaattggtt
agtaacggtacttttaccacaaaagaagtagagccatatagacatttaacaatggttgga
ttagttggctcaatcgataacgatatggcttcaacagactctactattggtgcatattca
gcattggagagaattaccgagatggttgattacattgatgctacagcttcttctcattcg
agagcttttattgttgaagttatgggtagacattgtgggtggttaggtttgatgtcgggt
cttgcgactggggctgactttattttcattcctgaaagaccaccaaaggcaggccaatgg
caaaacgaattaaaagatgtttgctcgagacatagacaaaaaggtaaaagaaacactact
gttattattgcagagggggcaattgatgatgatttaaacccgattacccctgatgaggtt
caaaaagttcttgttgcattaggtttagataccagaattactaccttaggccacgttcaa
agaggtggtacagccgtagcatatgaccgtttgttagcaacattacagggtgttgatgct
gttaaagctgtattggaattaactcctgatgacccttcacctatgatcggtagtttagaa
aacaagatcgtcagaaagcctttaatcgaagcagttaaattaactaagtctgtcgcgact
gctattgaaaataaagatttcgataaagctatgagtttaagagactctagtttcgaggat
gcatatcatcacttcttatcgtcttcaatctatgatgatggcctgaaaatattaccagaa
gcagaaagattgaatatcggtgtcgttcatgttggggcttcatcctcgggtttgaatgcg
gcaaccagagctgcagccttatactgtatgtctaaaggtcataaattatttgctattcaa
aacggttttagtggattaatcaatgaaggtgaaataaaggaattaagttggttagatgtc
gaaggatggcataacaaaggtggttcggaaattggcactaataggtcattaccaagtgag
gattttggtaacgttgcatactatttccaaaagttcaagcttcaaggtttgataataatc
ggtggctttgaaagtttttcagctttaaatgaattggatgaaaaaaaacaagaatatcct
attttcaatattccgatggttgttatacctgcaaccgtgtctaataacgtgccgggtaca
gaatattcgttgggtggtgacacctgtatgaatcaattgcttaaatattgtgatgctgta
aagcaatcagcgtcttcatctagaagaagagtattcgtggttgaggttcaaggtggttat
tcagggtttgttgcctcatactgtggtttaatcactggatcacttgctacatatacccca
gaatccaaaatcgacttgaaaactatacaagaggacatagatcttttgtacgaggttttc
gaagatgacagaggtgaatataacaacgggaaaatgattatcagaaatgaacaagcttct
tctgtgtatactacagatctcattgccgacataattaaggaatctgccggtggaaggttt
gaaacaagaactgctgttccgggtcacgtccaacaggggtttactcctacgtccatggat
agagtaaatgcatgcagatttgccgtgaagtcgtgtcaatacatcgaagactggaacacg
aaattaggaggcttgattctggacatggatgccaccaaaacgaacagaagaagtcgttct
aatgtcaaaaacagtattgaacacattcttgaagagaaaaacggctctgctgttgtgctt
ggaatccagggtgcccaaatcaaattcaactctgtcgaagccttattcgctaaagacgct
aatattcccttgagaaagggcagagtggtccattggacagaaatgatcgaagtggccgat
atgttaagcggaagactcttattaagagaaaaaaagcaatga

DBGET integrated database retrieval system