KEGG   Debaryomyces hansenii: DEHA2G21032gHelp
Entry
DEHA2G21032g      CDS       T01026                                 

Definition
(RefSeq) DEHA2G21032p
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
dha  Debaryomyces hansenii
Pathway
dha00010  Glycolysis / Gluconeogenesis
dha00071  Fatty acid degradation
dha00350  Tyrosine metabolism
dha01100  Metabolic pathways
dha01110  Biosynthesis of secondary metabolites
dha01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DEHA2G21032g
  Lipid metabolism
   00071 Fatty acid degradation
    DEHA2G21032g
  Amino acid metabolism
   00350 Tyrosine metabolism
    DEHA2G21032g
Enzymes [BR:dha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DEHA2G21032g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 adh_short
Motif
Other DBs
NCBI-GeneID: 2905406
NCBI-ProteinID: XP_462457
UniProt: Q6BH64
Position
G:1701926..1702975
Genome map
AA seq 349 aa AA seqDB search
MSSIPETQKAVVFESNGGPLEYKEIAVPKPKSTEILINVKFSGICHTDLHAWKGDWPLPV
KLPLVGGHEGAGVVVAIGENVKGWEIGDLAGIKWLNGTCMNCEFCQNSNESNCPNADLSG
YTHDGSFQQYATADAVQAAKIPKGTDLAEVAPILCAGVTVYKALKSANLKAGQWVVISGA
GGGLGSLCIQYAAAMGYRVISIDGGEEKGEFVKSLGSEAYVDFTKSKDIVADIKKITNGG
AHGVINVSVSEKAMSQSCEYVRSRGTVVLVGLPAGAEIKTPVFDAVVRSIAIVGSYVGNR
ADTTEAIDFFSRGLIKCPIKIVGLSELPPVYEFMEQGKILGRYVVDTSK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcaattccagaaactcaaaaagccgtcgtattcgaatctaatggtggtccatta
gaatacaaagaaatcgcggtcccaaaaccaaaatcaactgaaattctaattaatgttaaa
ttctcaggtatttgtcatactgatcttcatgcatggaaaggggactggccattaccagtt
aaattgccattggtaggtggacatgaaggtgcgggtgttgttgttgccatcggtgaaaat
gtcaaaggatgggaaataggtgatttggctgggatcaagtggttgaatggtacttgcatg
aattgcgaattttgccaaaactccaacgaatccaattgtccaaatgctgacttatctggt
tatactcatgatgggtcgtttcaacagtatgcaacagcggatgcggtccaagcagcaaag
attcctaaaggtacagacttagctgaagtagctccaattttatgtgcaggtgttactgtt
tataaggcattaaagtctgctaacttaaaggcaggtcagtgggtggttatctctggtgct
ggtggaggtttgggatctttgtgtattcaatatgccgctgctatgggatatagagtaatt
tctatcgatggtggtgaagaaaaaggtgaattcgttaaatcgttaggttcagaagcatat
gttgattttactaagtccaaggatattgttgcagatatcaaaaaaatcacgaacggtggg
gcacatggagtaattaatgtatctgtatcggaaaaggctatgtcacaatcgtgtgaatat
gtcagatctcgtggtactgtcgtgctagttggtttgccagctggtgctgagattaagact
ccagtgtttgatgcagttgtcaggtcaattgctattgtgggttcatacgtgggtaataga
gctgatactacggaagcaattgatttcttttctcgtggattaattaaatgtcctattaaa
atcgttggtttatctgagttaccgccggtttacgaatttatggaacaaggaaaaatctta
ggtaggtatgttgtcgataccagtaaataa

DBGET integrated database retrieval system