KEGG   Debaryomyces hansenii: DEHA2G21032gHelp
Entry
DEHA2G21032g      CDS       T01026                                 

Definition
DEHA2G21032p
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
dha  Debaryomyces hansenii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:dha01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dha00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:dha00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:dha00350]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:1701926..1702975
Genome map
AA seq 349 aa AA seqDB search
MSSIPETQKAVVFESNGGPLEYKEIAVPKPKSTEILINVKFSGICHTDLHAWKGDWPLPV
KLPLVGGHEGAGVVVAIGENVKGWEIGDLAGIKWLNGTCMNCEFCQNSNESNCPNADLSG
YTHDGSFQQYATADAVQAAKIPKGTDLAEVAPILCAGVTVYKALKSANLKAGQWVVISGA
GGGLGSLCIQYAAAMGYRVISIDGGEEKGEFVKSLGSEAYVDFTKSKDIVADIKKITNGG
AHGVINVSVSEKAMSQSCEYVRSRGTVVLVGLPAGAEIKTPVFDAVVRSIAIVGSYVGNR
ADTTEAIDFFSRGLIKCPIKIVGLSELPPVYEFMEQGKILGRYVVDTSK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcaattccagaaactcaaaaagccgtcgtattcgaatctaatggtggtccatta
gaatacaaagaaatcgcggtcccaaaaccaaaatcaactgaaattctaattaatgttaaa
ttctcaggtatttgtcatactgatcttcatgcatggaaaggggactggccattaccagtt
aaattgccattggtaggtggacatgaaggtgcgggtgttgttgttgccatcggtgaaaat
gtcaaaggatgggaaataggtgatttggctgggatcaagtggttgaatggtacttgcatg
aattgcgaattttgccaaaactccaacgaatccaattgtccaaatgctgacttatctggt
tatactcatgatgggtcgtttcaacagtatgcaacagcggatgcggtccaagcagcaaag
attcctaaaggtacagacttagctgaagtagctccaattttatgtgcaggtgttactgtt
tataaggcattaaagtctgctaacttaaaggcaggtcagtgggtggttatctctggtgct
ggtggaggtttgggatctttgtgtattcaatatgccgctgctatgggatatagagtaatt
tctatcgatggtggtgaagaaaaaggtgaattcgttaaatcgttaggttcagaagcatat
gttgattttactaagtccaaggatattgttgcagatatcaaaaaaatcacgaacggtggg
gcacatggagtaattaatgtatctgtatcggaaaaggctatgtcacaatcgtgtgaatat
gtcagatctcgtggtactgtcgtgctagttggtttgccagctggtgctgagattaagact
ccagtgtttgatgcagttgtcaggtcaattgctattgtgggttcatacgtgggtaataga
gctgatactacggaagcaattgatttcttttctcgtggattaattaaatgtcctattaaa
atcgttggtttatctgagttaccgccggtttacgaatttatggaacaaggaaaaatctta
ggtaggtatgttgtcgataccagtaaataa

DBGET integrated database retrieval system