KEGG   Debaryomyces hansenii: DEHA2G22990gHelp
Entry
DEHA2G22990g      CDS       T01026                                 

Definition
DEHA2G22990p
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dha  Debaryomyces hansenii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    DEHA2G22990g
   00052 Galactose metabolism
    DEHA2G22990g
   00500 Starch and sucrose metabolism
    DEHA2G22990g
   00520 Amino sugar and nucleotide sugar metabolism
    DEHA2G22990g
Enzymes [BR:dha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     DEHA2G22990g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:join(1862035..1862082,1862218..1863672)
Genome map
AA seq 500 aa AA seqDB search
MSATAPKKHTKTQSTYAFDNTATNIAASQMRNALNNLADTVQDSEKQSRFENEMDSFFAL
FRRYLTDKAAGSTLDWEKVKSPSPDEVVQYKSLSENGANNLDKLAVLKLNGGLGTSMGCV
GPKSVIEVRDGNTFLDLSVRQIEHLNRKYDADVPLLLMNSFNTDADTEKIIKKYQGHRIR
VKTFNQSRFPRIFKDSLLPVPQSFDDDLDSWYPPGHGDLFESLISSGELDSLLEQGREVL
FVSNGDNLGATVDSKILDHMIDTGAEYIMELTDKTRADVKGGTLINYEGQVRLLEIAQVA
KEHVEDFKSIKKFKYFNTNNLWINLRAIKKLVEADGIQAEIIPNQKTISKGSSDINVLQL
ETAVGAAIKHFNKAHGVVVPRSRFLPVKTCSDLLLVKSDLFFLEHGALKLDPVRDGFANP
LIKLGSHFKKVSGFQSRIGHMPRILELDHLTITGNVTLGKNVTLKGTVIIVCNDGDKIDI
PNGSILENVVVTGNLTILEH
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctactgctccaaagaaacatactaagactcagtctacatatgcctttgataac
actgcaactaacattgcagcttctcaaatgcgtaatgcattgaacaacttagctgatact
gttcaggattctgaaaagcaatctagattcgaaaatgaaatggacagctttttcgcatta
ttcagaaggtatttaaccgataaggctgctggttctaccttagattgggagaaagttaaa
tctccatccccagatgaagttgttcaatacaagtcattgagcgaaaatggtgctaataat
ttggataaattggctgttttaaagttgaatggtggtttaggtacctcaatgggttgtgtt
ggtccaaagtctgttattgaagtaagagacggtaacacatttttggatttatctgtcaga
caaattgaacacttaaacagaaagtatgacgccgatgtgccattattattgatgaattct
ttcaacactgatgctgacactgaaaagattattaagaagtaccaaggacatagaattaga
gtcaaaactttcaaccaatcaagattcccaagaatattcaaggattccttattaccagtc
ccacaatcattcgatgatgacttagattcttggtaccctccaggtcatggtgatttgttt
gaatcattaatttcttctggtgaattagactctttattagaacaaggaagagaggtctta
ttcgtgtctaacggtgataatttgggtgcaactgtagactccaagattttagatcatatg
attgatactggcgctgaatacattatggaattaactgataaaactagagctgatgttaag
ggtggtactttaattaactatgagggacaagttagattattagaaattgcccaagttgcc
aaagaacacgttgaagattttaaatctatcaaaaaattcaagtatttcaatactaataac
ttgtggatcaacttaagagccatcaagaaattggttgaggcagacggcattcaggctgaa
attattccaaaccaaaaaactatttctaagggttcatcggacatcaacgtgttacaatta
gaaactgctgtgggtgcagctattaagcacttcaacaaggcacatggtgttgttgttcca
agatcaagattcttaccagtcaagacttgttctgatttgttattggttaaatctgattta
ttcttcttagaacatggtgctttaaaattagatcctgtaagagatggattcgctaatcca
ttgattaaattaggatctcacttcaaaaaagtctctggattccaatctagaattggccat
atgccaaggattttagaattggaccacttgactatcactggtaatgttacgttaggtaaa
aatgttactttgaagggtactgtcattattgtttgtaacgatggtgataagattgatatt
ccaaatggttctattttagaaaatgttgtcgttactggtaacttgactattttggaacat
tag

DBGET integrated database retrieval system