KEGG   Debaryomyces hansenii: DEHA2G23254gHelp
Entry
DEHA2G23254g      CDS       T01026                                 

Definition
DEHA2G23254p
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
dha  Debaryomyces hansenii
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:dha00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    DEHA2G23254g
  Replication and repair
   03420 Nucleotide excision repair
    DEHA2G23254g
Transcription machinery [BR:dha03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     DEHA2G23254g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:1885702..1887249
Genome map
AA seq 515 aa AA seqDB search
MSSSNLFKATVNEHLEGLPKQVQSRLYEAPATCLSIYRLLPPIAKFYIMTMLFYETPVAL
KDLDKWCKPTSRKFQFDSLKRLRALHLIEEDSSGSHIRLHPTFRQNFRDCLTGSQARNAF
GNLSTTPDEQSVSIKFLDSFALQKWESILHFMVGTELSVTPSNSVLSLLKSGGLMEGTNK
GGNRLNITNSGFQFLLQDINAQIWTLLLQYLNLTQDLNMDPVDVLNFIFILGSLELGKGY
TVSSLSETQISMLADLRDYGLIYQRSENSERFYPTRLATTLTSDSAALKSPSMAMEQALE
STTETEEQQNLASNSNQGTIILETNFKIYAYTNSPLEIAILNLFVHLKTRFSNMVCGQIT
RESIRNALYNGITADQIIKFLETHAHSQMKILAKERLDKKIEFDTSNNINTAGGAPQSQM
MTNENGTTVAQHKLEVLPPTVVDQIKLWQLELDRIQTFEGYLFKDFASQQEFEALSNYAS
EIGVLLWSNKSKMKFFVTKDGISQVADFASRNQRR
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctagtaacttattcaaagctactgttaacgagcatttggagggactaccaaaa
caagtccaatcaagattatatgaggcaccagcaacatgtctatcgatttatagattatta
cctccaatagctaaattctacataatgacaatgttattttatgaaacgccagtggcattg
aaggatttggataagtggtgtaagccaacgtcaagaaagtttcaatttgactcgttaaag
cgattgagggccttgcatctcatcgaggaagacagtagtggatcacatattaggttacat
cccactttcaggcagaatttccgtgattgtctcactggatcacaagctcgtaatgcattt
ggtaatttaagcacaacacccgatgaacaaagtgttagcatcaaattcttggactctttt
gcgctccaaaaatgggaaagtatattgcatttcatggttggaaccgaactaagtgtcaca
ccttcgaattctgtgttatcattgttaaaactgggtgggttaatggaaggaactaacaaa
ggtggaaataggttaaatatcactaattcagggtttcaatttttattacaagatatcaac
gcccaaatctggacattattattacaatatttaaatttaacgcaagacttaaatatggat
cctgtggacgtattgaactttattttcatattaggctctttggagttgggtaaagggtat
acagtttcaagtttgagtgaaacacaaataagtatgttggcagatttgagagattacggt
ttaatatatcaaagatcagaaaattccgaaagattttatcctacaagactagccaccacc
ttgacctccgattcagcggcattgaagtccccgtctatggctatggaacaagccttagaa
tcaactactgaaactgaagaacaacaaaatttggcatccaattcaaaccaggggacaatc
attcttgaaaccaattttaagatttatgcatatacaaattccccattggagatagcgatt
ttaaatctatttgtacatttaaagactcgattctctaacatggtatgtggtcaaatcaca
agagaatcgatcaggaatgccctatataacggtattaccgctgatcaaattattaagttt
ttggaaacacatgctcattctcaaatgaagatactagctaaagaaagattggataagaag
atagaatttgacactagcaataatattaacactgcagggggtgctccacagtcacaaatg
atgacgaatgaaaatggtactacggtagctcagcataaattggaagtattaccaccaaca
gtcgttgaccagatcaagctctggcagttagaattagatagaattcaaacatttgaggga
tacttatttaaagattttgcgagccaacaagaatttgaagcattgagtaattatgcttca
gaaataggtgttttactatggtcaaataagagtaaaatgaagttctttgttacaaaagac
ggaatttcacaggttgctgattttgctagtagaaatcaaagaaggtaa

DBGET integrated database retrieval system