KEGG   Debaryomyces hansenii: DEHA2G23254gHelp
Entry
DEHA2G23254g      CDS       T01026                                 

Definition
(RefSeq) DEHA2G23254p
  KO
K03144  transcription initiation factor TFIIH subunit 4
Organism
dha  Debaryomyces hansenii
Pathway
dha03022  Basal transcription factors
dha03420  Nucleotide excision repair
Module
dha_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:dha00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    DEHA2G23254g
  Replication and repair
   03420 Nucleotide excision repair
    DEHA2G23254g
Transcription machinery [BR:dha03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     DEHA2G23254g
DNA repair and recombination proteins [BR:dha03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     DEHA2G23254g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tfb2 Helicase_C_3 PUF
Motif
Other DBs
NCBI-GeneID: 8999303
NCBI-ProteinID: XP_002777731
UniProt: Q6BGW8
Position
G:1885702..1887249
Genome map
AA seq 515 aa AA seqDB search
MSSSNLFKATVNEHLEGLPKQVQSRLYEAPATCLSIYRLLPPIAKFYIMTMLFYETPVAL
KDLDKWCKPTSRKFQFDSLKRLRALHLIEEDSSGSHIRLHPTFRQNFRDCLTGSQARNAF
GNLSTTPDEQSVSIKFLDSFALQKWESILHFMVGTELSVTPSNSVLSLLKSGGLMEGTNK
GGNRLNITNSGFQFLLQDINAQIWTLLLQYLNLTQDLNMDPVDVLNFIFILGSLELGKGY
TVSSLSETQISMLADLRDYGLIYQRSENSERFYPTRLATTLTSDSAALKSPSMAMEQALE
STTETEEQQNLASNSNQGTIILETNFKIYAYTNSPLEIAILNLFVHLKTRFSNMVCGQIT
RESIRNALYNGITADQIIKFLETHAHSQMKILAKERLDKKIEFDTSNNINTAGGAPQSQM
MTNENGTTVAQHKLEVLPPTVVDQIKLWQLELDRIQTFEGYLFKDFASQQEFEALSNYAS
EIGVLLWSNKSKMKFFVTKDGISQVADFASRNQRR
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctagtaacttattcaaagctactgttaacgagcatttggagggactaccaaaa
caagtccaatcaagattatatgaggcaccagcaacatgtctatcgatttatagattatta
cctccaatagctaaattctacataatgacaatgttattttatgaaacgccagtggcattg
aaggatttggataagtggtgtaagccaacgtcaagaaagtttcaatttgactcgttaaag
cgattgagggccttgcatctcatcgaggaagacagtagtggatcacatattaggttacat
cccactttcaggcagaatttccgtgattgtctcactggatcacaagctcgtaatgcattt
ggtaatttaagcacaacacccgatgaacaaagtgttagcatcaaattcttggactctttt
gcgctccaaaaatgggaaagtatattgcatttcatggttggaaccgaactaagtgtcaca
ccttcgaattctgtgttatcattgttaaaactgggtgggttaatggaaggaactaacaaa
ggtggaaataggttaaatatcactaattcagggtttcaatttttattacaagatatcaac
gcccaaatctggacattattattacaatatttaaatttaacgcaagacttaaatatggat
cctgtggacgtattgaactttattttcatattaggctctttggagttgggtaaagggtat
acagtttcaagtttgagtgaaacacaaataagtatgttggcagatttgagagattacggt
ttaatatatcaaagatcagaaaattccgaaagattttatcctacaagactagccaccacc
ttgacctccgattcagcggcattgaagtccccgtctatggctatggaacaagccttagaa
tcaactactgaaactgaagaacaacaaaatttggcatccaattcaaaccaggggacaatc
attcttgaaaccaattttaagatttatgcatatacaaattccccattggagatagcgatt
ttaaatctatttgtacatttaaagactcgattctctaacatggtatgtggtcaaatcaca
agagaatcgatcaggaatgccctatataacggtattaccgctgatcaaattattaagttt
ttggaaacacatgctcattctcaaatgaagatactagctaaagaaagattggataagaag
atagaatttgacactagcaataatattaacactgcagggggtgctccacagtcacaaatg
atgacgaatgaaaatggtactacggtagctcagcataaattggaagtattaccaccaaca
gtcgttgaccagatcaagctctggcagttagaattagatagaattcaaacatttgaggga
tacttatttaaagattttgcgagccaacaagaatttgaagcattgagtaattatgcttca
gaaataggtgttttactatggtcaaataagagtaaaatgaagttctttgttacaaaagac
ggaatttcacaggttgctgattttgctagtagaaatcaaagaaggtaa

DBGET integrated database retrieval system