KEGG   Debaryomyces hansenii: DEHA2G23474gHelp
Entry
DEHA2G23474g      CDS       T01026                                 

Definition
DEHA2G23474p
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
dha  Debaryomyces hansenii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:complement(1897094..1898461)
Genome map
AA seq 455 aa AA seqDB search
MVDRKRNSSVISDNEENGRVDKKTKIKDEIEGDEVERDVKNEEANGADTDDKEEVRKDNE
EENAENGGGEGDDDDDDDDEAEEEKKRTTTFNFDGVTYSFKERPSVLEEKEGKIEFRVVN
NDNTKESLMVLTGLKNIFQKQLPKMPREYISRLVYDRSHLSMAVVRKPLTVVGGITYRPF
DNREFAEIVFCAISSTEQVRGYGAHLMNHLKDYCRATSNVKYFLTYADNYAIGYFKKQGF
NKEITLDKSVWMGYIKDYEGGTLMQCSMLPPILRYLDSAKILLLQKAAIEKKIKLRSKAH
VVRPGLQVFKTNKDAKLNPAKDIPGLAESGWSEEMDKLAQKPKRGPHYNFMVTLLSELTN
HPSAWPFSTPVNKEEVGDYYDVIKEPMDLSTMESKLENDKYDSFDQFLYDARLIFNNCRS
YNADSTTYFKNATKLEKFMNNKIKDSAEYSHFLDQ
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggtagacaggaagagaaactcttcagtgatatcagataatgaagagaatgggcgtgta
gataaaaaaacaaagataaaggatgagatagaaggtgatgaagtggagagggacgtgaag
aacgaagaggctaatggagctgatacagacgacaaggaagaagttagaaaggacaacgaa
gaagaaaatgcggaaaatggaggtggcgagggcgatgatgatgacgacgacgatgatgaa
gcagaagaagaaaagaaaagaacgacgacgttcaactttgatggggttacatattcgttt
aaagagcggccgtctgtgcttgaagaaaaggaaggtaagatcgagtttcgggtggtgaat
aatgataacacgaaggagagtttaatggtgttgacgggattgaagaatatctttcaaaag
cagttacccaagatgccgcgagaatatatatcgcggttggtgtatgacagatcgcactta
tctatggcagtggttcgtaagccgctaacagttgttgggggcataacctatcgtcctttt
gataatagggagtttgcagaaattgttttctgtgcgatttcttcgactgaacaggttcga
ggttacggtgcacatttgatgaatcatttgaaggactactgccgggccacttcaaatgtg
aaatatttccttacatatgcagataattatgccattggatatttcaagaaacagggcttc
aataaagaaatcacactagataaatctgtctggatgggttatatcaaggattatgaagga
ggtacactcatgcagtgttcaatgttaccgccaattttgaggtatttggacctggcaaag
attctattattgcaaaaagccgcgatagagaaaaagataaagctcagatcaaaggcccac
gtagtaaggccgggattgcaggttttcaaaacaaataaggatgcaaagctcaacccagcg
aaggatattcctgggttagcagagagtgggtggctggaggaaatggacaaattggcgcag
aagccgaagcgtggccctcattataactttatggtgacgctattgtcagagttgactaac
catccatctgcatggccattttcgactccagtaaacaaagaagaagttggtgattactac
gatgtcatcaaagaaccaatggatttatcaactatggaactgaaattagaaaatgataag
tatgattcatttgaccaattcttatatgatgccaggttgattttcaacaactgtcgctct
tataatgctgattctacgacttacttcaaaaacgctaccaaattagaaaaattcatgaac
aacaaaatcaaagacagtgctgagtactcacacttccttgatcagtaa

DBGET integrated database retrieval system