KEGG   Debaryomyces hansenii: DEHA2G24310gHelp
Entry
DEHA2G24310g      CDS       T01026                                 

Definition
DEHA2G24310p
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dha  Debaryomyces hansenii
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    DEHA2G24310g
Enzymes [BR:dha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     DEHA2G24310g
Exosome [BR:dha04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DEHA2G24310g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:complement(1955952..1957844)
Genome map
AA seq 630 aa AA seqDB search
MPRRQSNAPSQPVVATIDIGTTSARAILFNQGGVEVAKHQIEYSTTASEAPAESENKEQF
RRRSSLMRHNAPIFTAEGIAISITDDVEIENNSASVGPTLRFPQPGWVECMPVHILANAV
QCLIACLITLRKINQNPELKIKYKVKAIGIANMRETTIVWSRKTGKPLSNGITWTDTRTA
EIVQHLERTIDDERKEELKQKTGLPLSTYFSAAKLRWLIDNDDTIKEEYEKGDGNLMFGT
VDTWLIYHLTKERSFVSDVTNASRTYFMDLETRDYDDDLLDFWGIDPTRVALPKIVSSSE
FYGSFAAPNLSNLGFHNKITPEAYEILKTITGIPICGCLGDQSASLVGQLAFKPGSAKCT
YGTGCFLLYNTGNRKLISEHGTVTTIGFWFPNLKDEDANPHYALEGSIAVAGSIIQWLRD
NLKLIEHARDVGPLASQVDNAGGVVFIPAFSGLYAPYWDGGARGTIFGMTQYTSSSHIAR
AALEGVCYQVRAILRAMANDAGASEDFLEEALNRQNEKKPLSALSVDGGMSKADEVLQIQ
ADILGPCVTVKRANISECTALGAAIAAGLSFKDEEERVWKDFDDIYEKINGTDDEKNNFK
AKLPDSDRRKYWKRWEKAIDRAKGWLDEDN
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgccacgtcgtcaaagtaatgctccatcgcagccagttgttgctacgattgatattggt
acaacttcagcaagagctattttgtttaatcaaggaggtgttgaagtagccaaacatcaa
atcgaatactccaccacggcatcggaagctccagcggagtcggagaataaggaacagttt
agaagaagatcgtcgcttatgagacacaatgcgcctattttcactgctgaaggtattgcc
atttctataacagacgatgtcgaaatcgaaaataattctgcaagtgttggtcctacgttg
agatttccacagcccggatgggttgagtgtatgccagttcatattttggcgaatgctgtt
cagtgtttgatagcttgtttgattacgttgagaaaaatcaatcagaatccggagttgaaa
atcaagtataaggtcaaggctattggtattgctaacatgagagaaacaacgattgtgtgg
tctcgtaaaaccggtaagcctttgagtaatggtatcacatggactgatacaagaactgca
gaaattgtgcagcacttggaaaggacaattgacgatgaaagaaaagaagaattaaagcaa
aagaccgggttgccattatccacctatttttctgccgccaaattgcgttggttaatagat
aatgacgataccataaaggaggaatacgagaagggtgatggtaacttaatgtttggtacg
gttgatacgtggttgatttatcacttaaccaaggaaagatcctttgtatccgacgttacc
aatgcatctagaacttattttatggacttagaaacaagagattatgacgatgatttatta
gatttttggggtattgatcctacgagggtagcgttaccaaagattgtatctagttcggaa
ttctacggatcatttgcggctccaaatttatctaacttaggtttccacaataagatcact
ccagaagcatacgaaatattgaaaactattaccggcattcccatttgtgggtgtcttggt
gaccagtcagcttcattagttggccaattagcatttaagcctggttctgctaaatgtact
tatggtactggttgtttcttgttgtataataccggtaatcgtaagttaatctctgaacat
ggcacagtaacaacgataggcttttggttccctaacttaaaggacgaggacgccaatcca
cattatgcattagaaggttcaattgctgttgcaggttcaattattcaatggttaagagat
aatttgaagttgatagaacacgcgagagatgttggacctttggcctcccaagttgataat
gcaggtggagttgtatttatcccagctttctcaggtttatatgctccatactgggatggt
ggcgctagaggtacaatttttggtatgacacaatatacctcttcatctcatatagcaaga
gctgcattagaaggtgtctgttatcaagttagggctatcttgagagccatggctaatgat
gcgggcgcaagtgaagattttttggaagaagcgttaaataggcaaaatgagaaaaagcca
ttatctgcattatctgttgatggtggtatgtcaaaggctgatgaggtgttgcaaattcaa
gcggacattttaggaccatgtgtaactgtcaaaagggcaaatatatctgaatgtacagca
ttgggtgcagcgattgcagccggcttatcattcaaagatgaagaagaaagagtttggaaa
gatttcgatgatatttatgaaaagattaatggaacggatgatgagaagaataatttcaaa
gcgaaattgcctgattccgatagaagaaagtattggaagaggtgggagaaagcaatcgat
agagctaaaggttggttagatgaagataattag

DBGET integrated database retrieval system