KEGG   Debaryomyces hansenii: DEHA2G24706gHelp
Entry
DEHA2G24706g      CDS       T01026                                 

Definition
DEHA2G24706p
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
dha  Debaryomyces hansenii
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dha01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:dha00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:join(1996422..1996428,1996488..1997431)
Genome map
AA seq 316 aa AA seqDB search
MSVEYKYHPKKQATIVTAPFSGGQPKGGVELGPEYILKAGFQEQLQSLGWNVELENPLES
TNYEKSKSDDKDEYGIKNTKIVSECCEKIHNSVKGIANNGRLPITVGGDHSIGTATVSAM
LAHNPDTCILWVDAHADINTPKTTDSGNLHGCPLSFVMGLDSDSYPEEFSWVPQLLKANK
IAYIGLRDVDDGEKRILKENNIAAFSMYHIDKYGIGQVVDMALNKINPDRDCPIHLSYDV
DAIDPSFVPATGTRVEGGLTLREGLFVAEAVAETGLLSSLDIVETNPLLGENDNHVLDTV
SAACAIGRCALGQTLL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtcgaatacaaatatcatccaaagaaacaagccactatcgtgacggcaccattt
tcaggtggacaaccaaaaggtggtgtggagttaggaccagaatatattttaaaggcggga
tttcaagaacagcttcagtcgttagggtggaatgttgaattagagaacccactagaaagc
acgaactacgagaagagtaaaagcgatgataaggacgagtatgggattaagaacaccaag
attgtaagcgagtgttgtgaaaaaattcacaactcagtcaagggtattgcaaataacggc
agattgcctataactgttggtggagatcattctattggtacagctactgtgagtgccatg
ttggcacacaatccagatacatgcatattatgggtggatgcacatgctgatataaacacg
cctaagacaacagatctgggtaacttgcatggctgcccattgtcgtttgtcatgggattg
gacagtgattcatatcctgaagaattcagctgggtgccccagttgttgaaggctaataag
attgcgtacataggcttgagagatgtggatgatggagaaaaacgtatattgaaagaaaat
aatatagcagcattctctatgtatcatatcgacaaatatggtattggccaagttgttgat
atggcgttgaacaaaatcaatccagatagagactgtcctattcatttatcatatgatgtt
gatgcgattgatccatcgtttgtacctgcaactggtactagagtagaaggtggtttgaca
ttaagagaaggtttatttgtggccgaggcagttgcggaaactggattattgtcttccttg
gatattgttgaaacaaatcctttattgggtgaaaacgataatcatgtattagatactgtc
agtgctgcttgtgcaattggaaggtgtgctttaggtcaaactttattataa

DBGET integrated database retrieval system