KEGG   Debaryomyces hansenii: DEHA2G24706gHelp
Entry
DEHA2G24706g      CDS       T01026                                 

Definition
(RefSeq) DEHA2G24706p
  KO
K01476  arginase [EC:3.5.3.1]
Organism
dha  Debaryomyces hansenii
Pathway
dha00220  Arginine biosynthesis
dha00330  Arginine and proline metabolism
dha01100  Metabolic pathways
dha01110  Biosynthesis of secondary metabolites
dha01130  Biosynthesis of antibiotics
dha01230  Biosynthesis of amino acids
Module
dha_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    DEHA2G24706g
   00330 Arginine and proline metabolism
    DEHA2G24706g
Enzymes [BR:dha01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     DEHA2G24706g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 8999312
NCBI-ProteinID: XP_002777736
UniProt: B5RV02
Position
G:join(1996422..1996428,1996488..1997431)
Genome map
AA seq 316 aa AA seqDB search
MSVEYKYHPKKQATIVTAPFSGGQPKGGVELGPEYILKAGFQEQLQSLGWNVELENPLES
TNYEKSKSDDKDEYGIKNTKIVSECCEKIHNSVKGIANNGRLPITVGGDHSIGTATVSAM
LAHNPDTCILWVDAHADINTPKTTDSGNLHGCPLSFVMGLDSDSYPEEFSWVPQLLKANK
IAYIGLRDVDDGEKRILKENNIAAFSMYHIDKYGIGQVVDMALNKINPDRDCPIHLSYDV
DAIDPSFVPATGTRVEGGLTLREGLFVAEAVAETGLLSSLDIVETNPLLGENDNHVLDTV
SAACAIGRCALGQTLL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtcgaatacaaatatcatccaaagaaacaagccactatcgtgacggcaccattt
tcaggtggacaaccaaaaggtggtgtggagttaggaccagaatatattttaaaggcggga
tttcaagaacagcttcagtcgttagggtggaatgttgaattagagaacccactagaaagc
acgaactacgagaagagtaaaagcgatgataaggacgagtatgggattaagaacaccaag
attgtaagcgagtgttgtgaaaaaattcacaactcagtcaagggtattgcaaataacggc
agattgcctataactgttggtggagatcattctattggtacagctactgtgagtgccatg
ttggcacacaatccagatacatgcatattatgggtggatgcacatgctgatataaacacg
cctaagacaacagatctgggtaacttgcatggctgcccattgtcgtttgtcatgggattg
gacagtgattcatatcctgaagaattcagctgggtgccccagttgttgaaggctaataag
attgcgtacataggcttgagagatgtggatgatggagaaaaacgtatattgaaagaaaat
aatatagcagcattctctatgtatcatatcgacaaatatggtattggccaagttgttgat
atggcgttgaacaaaatcaatccagatagagactgtcctattcatttatcatatgatgtt
gatgcgattgatccatcgtttgtacctgcaactggtactagagtagaaggtggtttgaca
ttaagagaaggtttatttgtggccgaggcagttgcggaaactggattattgtcttccttg
gatattgttgaaacaaatcctttattgggtgaaaacgataatcatgtattagatactgtc
agtgctgcttgtgcaattggaaggtgtgctttaggtcaaactttattataa

DBGET integrated database retrieval system