KEGG   Debaryomyces hansenii: DEHA2G24860gHelp
Entry
DEHA2G24860g      CDS       T01026                                 

Definition
DEHA2G24860p
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
dha  Debaryomyces hansenii
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    DEHA2G24860g
  Lipid metabolism
   00600 Sphingolipid metabolism
    DEHA2G24860g
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    DEHA2G24860g
Enzymes [BR:dha01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     DEHA2G24860g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:complement(2010455..2013523)
Genome map
AA seq 1022 aa AA seqDB search
MTEYTAQTLQSVLSNPKIVEINRLDSRAYYLPSDSTLSLNGNWDFNYSQSPLVAPLPHDK
FAEFPGRLIVPGHWQLQGYGKPHYTNVVFPFAVDPPNPPSQNPTGTYRRKFVVPDEWKSK
PFLFRLRFEGVDNSFHIFLNGKLVGYNEGSRNASEFDVAEHILLDEVNELWVRVYQWSSS
SYIEDQDQWWLSGIFRDVYLLGFNKSGFIEDFNIVTDLDNKYVDSRLTINSKINFITSNS
KLHVLLKREEDEIINKIFDLKDSNFNECLEVQNPLKWTAESPNLYNLELSVLVDNKVTNK
VEQDVGFRKVEMKNGTLRVNGKSILIRGVNRHDHHPKHGRAVPLEYIKRDLYIMKKHNIN
AIRTSHYPNHPKFYELANRLGFWVLDEADLECHGFFEAVRKPVGGNDDAEYDEEKLRLFK
LANQFTSDNKEWEAAYVDRAYQLVKRDFNQPCVFLWSLGNEAFYGYNHKSMVAKIRELDT
SRPIHYEGDLQAESTDLYSRMYPSFQTLDKFVNQSEKPLILCEYGHAMGNSPGLLRQYQD
YFYKYDQLQGGFIWEWANHGLYVNKDGQDIYYYGGDFGEYPHDGVFIMDGLLDSQHNPTP
GLIEYAKVIEPIVIKIDKDKIKITNTFDFIDLDNYTATYQVVNYSDLDRKIIKRGELTLP
KINAQETVEVSLPGYPQIVSSGTNCLEVQFKTINHTEAVESGHVVSWSQYELEKFPKRHV
HQSYDRNLVEFAEDKLKFQIKSPYSDFVFDKISGCISNWQNDTNNLISKGINNLTFWRPS
INNDAPVDEPYWRRFGLDHMQYNIRNIHIDKFPDSERIALIKVESLISPPILSWGFKTIQ
EYSIFTNEIKIYTKLTPEGFKDICIPETIPRLGYEFEINDELGRFVKWFGRGPGESYSDK
KESQRIDVYRLPFEDLDYSYEYPQENGNHEETEWLLLENDNESGLYVTMEGKRFGYKASD
EYDVQEAKHPHEIKHGSKYIRIDYKQHGVGTGACGPRVLDEFEFKISKETPIIFTISLKG
LK
NT seq 3069 nt NT seq  +upstreamnt  +downstreamnt
atgacagaatatacagcacagacactccaatcggtactttcaaacccaaaaattgtcgag
atcaatagactagactctagggcttactatttacctagcgactcaacattgagtcttaat
gggaattgggatttcaattactcccagtctccattagttgcacctttacctcacgacaaa
tttgcagaattcccaggtaggttgattgttcctggtcattggcaactacaaggatatggg
aaaccacattatactaatgtcgtgttcccatttgcagtggaccctcctaatccaccatcg
cagaacccaactggtacataccgccgtaagtttgttgttccagatgagtggaaatcaaag
ccttttttattcagacttcggtttgaaggtgtagataattcgtttcatatatttcttaat
ggtaaactagttggttataatgagggtagtagaaatgcatctgaatttgatgttgctgaa
catattttattagacgaagttaatgaattatgggtcagggtatatcagtggtcttcttct
tcatatattgaagaccaagaccagtggtggttgagtggtatttttagagatgtctactta
ttagggttcaataagagtggattcattgaggattttaatattgtgaccgacttggataat
aagtacgtggactcaagattaacaatcaacctgaagataaacttcattacctcgaattct
aaattacatgtattattaaaacgtgaagaggatgaaataataaataagatttttgattta
aaagactcaaattttaatgagtgcttagaagtacaaaacccacttaaatggacagccgaa
tccccaaacctttataatcttgaattatcggttttagtagacaataaggtaacgaataag
gtagaacaagatgtgggatttcgtaaggttgaaatgaaaaatggaacattaagggttaac
ggtaagtctatattaataaggggggtcaatagacatgaccaccatccaaagcacggcaga
gcagtaccattagaatacataaaacgtgatttatatattatgaaaaagcataacatcaat
gctattcgtacatcgcattatccaaatcaccccaagttttatgaattggcaaaccgttta
ggattttgggttcttgatgaagcagacctagaatgtcatggattctttgaagcagttaga
aagccagttgggggcaatgatgatgctgaatatgacgaagaaaagctacgcttattcaaa
ttagcaaaccaatttacttccgataataaagaatgggaagcagcttatgttgacagagct
tatcagttagtaaagagagattttaaccaaccttgtgtatttttatggtcgcttggaaac
gaagctttctatggctataatcataaatcaatggttgcgaaaatcagggaattagacact
tcgcgcccaattcattatgaaggagaccttcaagcagagtctacagacttatatagccga
atgtatcctctgttccagactctcgataagtttgtgaatcaatcggagaagccattgatt
ttatgtgaatatggccatgcaatgggaaatagcccaggtcttttaagacaatatcaggac
tatttctacaaatatgatcagcttcaaggaggatttatatgggagtgggccaatcatgga
ttatacgtaaataaagatggtcaagacatttattattacggaggagacttcggtgaatat
cctcacgatggggttttcatcatggatggacttttagattctcaacataatccaactcca
ggattaattgaatatgccaaggttattgagcctatagtgattaaaatagataaagataaa
ataaaaattactaacacatttgactttattgacttagataattacactgcaacataccag
gtagttaactactcggatttagatagaaaaataatcaagagaggtgaattaactttacct
aagattaatgcgcaagaaactgttgaagtatcattaccaggatatccgcaaattgtttcg
agcggcacgaattgcttagaagtacagttcaagacaataaatcatacagaagctgttgaa
agtggacatgtcgtgtcatggtcacagtatgaattagaaaagtttccaaaaagacatgtt
catcaatcttatgatagaaatttggttgaatttgctgaagataagttaaagtttcaaatt
aagagtccctattcagactttgttttcgataagatatctgggtgtatttcaaattggcaa
aatgataccaacaatttaatttcgaaaggtattaataatttaaccttttggagaccgagt
attaataacgacgcaccggtagatgagccatactggcgccgatttggtcttgatcatatg
caatacaatattagaaacattcatatagataagtttcctgattcagaaaggatagcttta
ataaaagtggaatctttaatttcaccgccaattttatcttgggggtttaaaactattcaa
gaatattcgatttttacaaatgagataaagatttatacaaagttgacccctgaaggattc
aaagatatatgtatcccagaaactattccaaggttgggatatgaatttgaaatcaatgat
gaattgggtagatttgttaaatggtttggtagaggccccggcgaaagttatagtgacaag
aaagaatcacaaaggatagatgtttatagattaccgtttgaagatcttgattattcatac
gaatatccacaggaaaatggtaatcacgaagaaacagaatggttattattagagaatgac
aatgaatcggggctttatgttacaatggaaggtaaacgattcggatataaagcatcagac
gaatacgatgttcaagaagccaaacatcctcatgaaataaagcatggctcgaagtatatt
aggattgattacaagcaacatggagttggtacgggtgcatgtggtccaagagtcctagat
gagtttgaattcaaaatttctaaagagacgccaattatttttaccattagtttaaaaggt
ttgaaatag

DBGET integrated database retrieval system