KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_0052Help
Entry
Dhaf_0052         CDS       T00822                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
dhd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:dhd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dhaf_0052
DNA repair and recombination proteins [BR:dhd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Dhaf_0052
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Dhaf_0052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_8 HHH_5 IMS_HHH DUF3701
Motif
Other DBs
NCBI-ProteinID: ACL18121
JGI: Dhaf0052
UniProt: B8FY16
Position
49703..50299
Genome map
AA seq 198 aa AA seqDB search
MDFLNYPEPLADLITGLSRLPGIGPKTAGRLAFYLLQQPQVAENLAEAMIRAQREIRQCS
LCCNYTDHDPCPICTGEKRERTLLCIVEQPRDVVSLEKTREFKGLYHVLHGVISPLEGVG
PEQLTISKLLGRLEGVQEVVMAMNPTVEGEATALYLSRLLKPLGIKVTRIAHGLPVGGDL
EYADEITIARALEGRRQI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggattttttgaattatcctgaacccctggccgatttgattacaggtttatcccgcttg
cctgggatcggaccgaaaacggcgggtcgtttggctttttacctgctgcagcaaccccag
gtggccgaaaacctagcggaagccatgatcagagctcagcgggaaatcaggcagtgttcc
ctatgctgtaattatacggatcatgatccctgccccatctgtaccggggagaaaagggag
cgtaccctgctctgcattgtggagcagccccgggatgtggtttctttagagaaaacaaga
gaatttaaagggctttatcatgtcctgcatggcgtcatatctcctttggaaggagtcggg
ccggagcagctgacgatttccaagcttttagggcgtttagaaggagtccaggaagtcgtc
atggctatgaaccccacggtagagggagaagctacggcactgtatttatccaggctgctt
aagcctttgggaatcaaggtaacacggattgcccatggtttaccggtgggcggtgatctg
gagtatgccgatgaaattaccatcgcccgtgctttagaaggccgtcgccagatctaa

DBGET integrated database retrieval system