KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_0151Help
Entry
Dhaf_0151         CDS       T00822                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dhd00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
159296..160519
Genome map
AA seq 407 aa AA seqDB search
MKDYSPRWISLNNETEAKKAMQQIGSDPGGIAHMVGKPIGRALKLENVPLPAAHIIKQEM
LSLGGDAAVHRNVIVNKIEASDILLVGTAKHFRRLSQKLAAQPFGLKDLGKSLKGLLDAL
EPPKQRVLPCRGKDIVLGERTLIMGILNLTPDSFSDGGKFNTLERALKQAEALVEQGADI
LDIGAESTRINHEPVSAEEEWERLEAVLKALLPRIAVPISVDTYKADVAERALAAGVHMI
NDVWGLQKDPRMAEVVGRAQAPVIVMHNQEGSNYHHLMGDIMAYLKKSIHLAEEQGLAGD
QIIIDPGIGGTAFGKSLDIDLEIMSRLEEFRSLGRPILLGTSRKSMIGQTLNLPTEERLE
GTLATSVVGVAAGVDILRVHDVQANKRAVQMADAIYRRKRGENFSGS
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattattccccgcgctggatcagcctcaataacgaaacagaagcaaaaaaagcg
atgcagcaaattggctccgacccgggaggaattgctcatatggttggcaaacccatcggc
agagctctcaagctggagaatgtgcctttgcctgccgctcatatcattaagcaggaaatg
ctatctctgggaggggacgcggcggttcatcgcaatgttattgtcaataagattgaagcc
tcggatattttgctggtgggaacagcaaaacattttcgccggctcagtcaaaagctggcg
gctcaaccctttggtttaaaggatttgggtaaaagcttaaagggtcttctggacgctctg
gaacctcctaagcaaagagttctcccctgtcgtgggaaggatattgtgttgggtgaacgc
accctgatcatggggatactcaaccttactccggattccttttccgatggcggaaaattc
aatactttggagcgtgccctaaagcaagcggaggccttggttgaacaaggggcggatatt
ttggacatcggagcagagtccacccgcatcaatcacgagccggtcagtgccgaagaggaa
tgggagcgtctggaggctgtccttaaggctttgttgccacggattgctgttcccatttcg
gtggatacttataaagcagatgtggcagagagggcattggctgccggggtacatatgatt
aatgatgtctggggattgcaaaaagaccccagaatggcagaggtcgtggggagagctcag
gcaccggtgattgtcatgcataatcaagagggaagcaactaccatcacctcatgggggat
ataatggcttacctgaaaaagagcattcatcttgccgaggaacagggattagcaggtgat
cagatcatcatcgatccgggcattggcggaacagccttcggcaaaagtctggatatcgat
ctggaaatcatgagccgtctggaagaattccgctctttaggccgtcctatccttttgggg
acctcacggaaatccatgatcggtcaaaccctgaacctccccacggaggaacggttggaa
ggaaccctggctaccagcgtggtaggcgtggccgccggggtggatattcttcgggttcat
gatgtccaagccaataagagagcggttcagatggctgatgccatctatcgccgcaagaga
ggggagaactttagtggatcgtga

DBGET integrated database retrieval system