KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_0153Help
Entry
Dhaf_0153         CDS       T00822                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dhd00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
160874..161347
Genome map
AA seq 157 aa AA seqDB search
MKAYLSIGSNLGDRGHYLQQSCQRLAEHPDVKIIKKSGTYETKPWGNVDQPDFWNQVLEI
ETSLAPLDLLNLCQEVEKSLGRERLIRWGPRTIDIDLLNYDNKVWEDERLILPHPRMEER
EFVLAPLREIAPHYILPSGKKVTEVCGDGEVWRLESK
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcgtatttgagtattggcagcaatctgggggaccgggggcattatttgcagcag
agctgtcaaaggctggcggaacacccggatgttaagatcatcaaaaagtccggcacgtat
gaaacaaagccctggggcaatgtggatcaaccggatttctggaatcaagtgctggagatt
gagacctcattagcgcctctggacctgttgaatctgtgtcaagaggttgaaaaatccctc
gggagagaaagacttattcgttgggggccaagaaccattgacattgacctcctaaattat
gataataaggtatgggaggacgaacggcttattctccctcatccccgcatggaagagcgg
gagtttgttctggcacccttacgggaaatagctccacactatatccttccttcaggaaaa
aaggttacagaagtttgtggagatggagaggtatggcgactggaatctaaataa

DBGET integrated database retrieval system