KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_0178Help
Entry
Dhaf_0178         CDS       T00822                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dhd00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Dhaf_0178
Enzymes [BR:dhd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Dhaf_0178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
195665..196522
Genome map
AA seq 285 aa AA seqDB search
MKMTESPGVFMGGETPYEEADAVILGIPMDYTVSFRPGTRLGPLSIRNVSIGIEEYSVYL
DKDLSDYAYCDCGDLSLPFGNVEKSLQVIEAAARQVVEDGKFPIFLGGEHLVTYPLLKPF
IEKYPELRVVHFDAHADLRTDYSGEPNSHATVMRKISEALGPHRVYQFGIRSGTREEFLF
AKEHNHLVVEEVLEPLKAVLPELKGKPVYVTLDIDVVDPAFAPGTGTQEAGGCTSREIIK
AVHALSELDVVGFDLVEVSPLMDTSERTALLAAKIVREAILSFVK
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgacagaaagccccggtgtgtttatgggaggagaaaccccttatgaagaggct
gacgcggtaattttggggattcctatggattatacggtgagttttcgcccgggtacccgt
ttgggccccctgagtatccgcaatgtctccatcgggattgaggaatatagtgtgtatctg
gataaggatctctctgattatgcttattgcgattgtggagatttaagcctgccctttggc
aatgttgaaaaatctttgcaagtgatcgaagccgctgcccggcaggtggtagaagacggg
aaatttcccattttcttagggggagaacacctggttacctatcctttgcttaaacccttc
attgagaagtatcctgagctccgggtggtgcattttgacgcccatgccgatttgcgtaca
gattactccggtgagcctaattcccatgctacggtgatgcgcaaaatctcggaagctctg
gggccccaccgggtctaccagtttggcatacgctccggaacccgggaggaattccttttt
gctaaggaacacaatcatttggtggtagaagaggttttggagcccctcaaggctgtcctg
ccggagcttaaagggaagccggtctatgtgacgctagatattgatgtggtggatccggcc
tttgccccaggcactgggactcaggaagccggtggatgtacttcccgggaaatcatcaaa
gccgttcatgccctcagtgagctggatgtggtgggctttgatctggtggaagtatcccct
cttatggacaccagtgagcgtacggctcttttagcagcgaagatcgtaagggaagcaatt
ttgagttttgtaaaataa

DBGET integrated database retrieval system