KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_0209Help
Entry
Dhaf_0209         CDS       T00822                                 

Definition
nitrous-oxide reductase
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dhd00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Dhaf_0209
Enzymes [BR:dhd01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     Dhaf_0209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
228787..230685
Genome map
AA seq 632 aa AA seqDB search
MEKGLFKKIVLSLAGLLVGLVIAVYLSAQLNPEAEAAAAFGGKNISVDGVPDDVVQAALK
TYVPPGQLDEYYMFASGGHSGNVFVYGVPSMRRIRTIPVFTPESAVGYGWTTESKEMLGE
WSWGDVHHPALSETKGDYDGRWLFVNDNANSRAARIDLDSFRTSQILDIPNIYGPHSAVF
MTPNSEYFMLGSRFAGPIPYGTYSPIENLSKDYNCVLAAVAIDPNNGEMSVGWEVLMPPW
SFDLSDAGKLDSEGWAFLTTYNTEEAYELLEVNASQREMDYVVALNWKMLEQAANEGKYK
IVDGVKMIDPLDVPGSVYLVPAMKSPHGVDVTPDGKYFIANGKVAPVATVFSFEKFKECI
DNKDFQGEERGFPVVNYEKVRVAEVPVGLGPLHTQFDGNGYAYTTLFIDSTIAKWSLDTF
EVVDVTPVHYCPGHLCAAEGDTVSPDGKYLVSLNKLAKDKFLSVGPSHPESAQLIDLTTD
KMKILMDVPTDPEPHFAQMIKADKITTWEVFEKDPSQPGAVYEKENARIERDGNNVTVYQ
MGFRSRYYPDHVEVNEGDHVTWYLTNTDFDEDITHGFGICLYDLNAEAQPGETIKFEFVA
DKAGVYPFYCTNFCSALHQEMQGWFIVKPKGL
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaaaggactgtttaagaagattgtattgtccctggcagggctgctggttggcctg
gtcatagctgtttacttatccgcccagcttaatcccgaggcggaggcggctgctgccttc
ggcgggaaaaatatatctgtggacggagtgcctgacgatgtggtgcaggcggctctgaaa
acctatgtgccacccggtcagctggatgagtattatatgtttgcctcagggggccattcc
ggtaatgtcttcgtctatggtgtgccatccatgcggcggattagaacaattccggtattt
acccccgagtccgccgtggggtatggctggacgacggaatccaaggaaatgcttggcgaa
tggagctggggggatgtccatcatcctgctttgagcgagaccaagggagattatgacggg
cgctggctttttgtcaatgataatgccaacagcagggccgcccggatcgatctggattcc
ttcaggactagtcaaattttggatattcctaatatttatggaccccacagcgctgtattt
atgacacctaactccgaatactttatgctggggtcccgctttgccggaccgataccctat
gggacctattctcccattgagaatttatcaaaagattataattgtgttttagcagcagta
gctatcgaccccaataatggtgagatgagcgtggggtgggaagtgctgatgcccccctgg
tccttcgatttatcggatgccggtaagctggacagtgagggctgggcctttctgacgacc
tataatactgaggaggcctatgagctgctggaggtcaatgcctcccagcgggaaatggat
tatgtggtcgctttaaattggaaaatgcttgaacaggcggccaatgaaggaaaatacaaa
atagttgatggcgtcaaaatgattgatcccctggatgtaccgggctccgtctacttggtc
ccggctatgaagagcccccatggtgtggatgtcacaccggatggaaagtattttattgct
aacggaaaagtggctccggtagctaccgtattcagctttgagaaattcaaggaatgcatt
gacaacaaagacttccagggcgaggaacgaggtttcccggttgtcaattacgagaaagta
agagtggcggaagtgccggtgggcttaggaccattgcatactcaatttgacggcaacggt
tatgcctataccaccttattcatcgacagtactattgccaaatggagtctggacaccttt
gaggttgtcgacgttactccggtacattattgcccgggtcatctgtgtgctgctgaggga
gacactgtctctccggacggcaagtatctggtctccttaaataagctggccaaggataag
ttcttgtccgttgggccatcccatcccgaaagcgcccagctgattgatttaaccacggat
aagatgaaaatcttaatggatgttcccacagatcctgagcctcacttcgctcagatgatt
aaagccgataagattacgacctgggaagtttttgagaaggatcccagtcagccgggtgct
gtctatgagaaagaaaatgcccgcattgaacgggatggcaacaatgtcacagtctatcaa
atgggcttccgcagccgctattacccggatcatgtggaggtcaatgaaggggatcatgtg
acctggtatttaaccaatacggatttcgatgaggatatcacccatggctttggtatttgt
ctgtatgaccttaatgcggaagcacaaccgggtgagacgataaaatttgaatttgtcgcc
gataaagcgggagtctatcctttctattgcaccaacttctgctcggccctccatcaggaa
atgcagggctggtttattgtcaaaccaaaaggcctataa

DBGET integrated database retrieval system