KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_0396Help
Entry
Dhaf_0396         CDS       T00822                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:dhd00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
437843..439309
Genome map
AA seq 488 aa AA seqDB search
MLKVRFAPSPTGPLHIGGARSALFNYLLARKEDGVFIVRSEDTDLERSSRESEHNIMEAL
RWLNIQWDEGIEVGGDNGPYRQTERLALYQEYTDRLLASGDAYYCYCSEEELEQERQDLM
AKGETPRYLGKCRHLSAAERQTYEAAGRKPVVRFRVPEGRQILINDRVRGEVVFDSDGIG
DYVIVKSDGIPTYNFAVVIDDTTMNITHVIRGEEHLSNTPRQVLIYQALGLPTPEFAHIS
LILNTEGKKMSKRDGDTAVIDYQAKGYLPEAVVNFIALMGWSPPGEEEFFTLEEMTQAFS
LERVSKSPAVFDLNKLNYMNAHYIKQADPERLTDLAVPYLREMGAIPQGTLSEEERAWVT
HYVQAIINHLSYMAQVKDFVHYVQGGEAPTPEGEALEILQGEQVPAVLDLFVEKLKSLEA
IRVDTVKPLFKQITKETKLGGKQVFMPIRIALTGQMHGPELYDIVPLLGLENVLSRLAGT
KALLAGSR
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaagttcgttttgcccccagcccgacgggccccttacatatcggcggtgcacgt
tccgccctctttaattacctgctcgcccgcaaagaagacggggtttttatcgtccgcagt
gaggataccgatctggagcgctccagccgggaatcggaacacaatattatggaggctctg
cgctggctcaacattcaatgggatgaaggaatcgaagtcggcggcgacaacggaccttac
cgccagaccgagcgtctggctctttatcaggaatatacggacaggcttctcgccagcgga
gacgcctattattgctattgttcagaagaagagctggagcaggaacgccaggatttgatg
gctaaaggggaaactccccgctacctgggtaaatgccgtcatctttccgcagcagagcgc
caaacatacgaagcggcgggccgtaaacctgtggttcgttttcgggtgcctgaaggccgg
cagatcctgatcaacgaccgggtgcggggagaagtggtctttgacagcgacggcatcggc
gattatgtcatcgttaagtccgatggcattcccacctataattttgccgtggtcatcgac
gataccactatgaatatcacccatgtcatccgcggggaagaacatctctccaatactccc
cgacaagtgctgatttaccaggctttaggcctccccactccggaattcgctcatatctcc
ctgattctcaacactgaaggaaaaaagatgagcaaacgggatggggatacagcggttatc
gattatcaggccaaaggatatctgccggaggctgtggtgaatttcattgccctgatgggc
tggtctcccccgggggaagaagaattctttaccctggaggaaatgacccaagccttctct
ttggagcgggtctccaagagtccggcggtttttgacttgaataaactaaactatatgaac
gctcattatattaagcaggcggaccccgagcgactcacagatttggctgtgccttatctc
cgggagatgggagctattccccagggaaccctttccgaagaggaacgggcctgggtgact
cactacgttcaagccatcattaatcacctatcctatatggctcaggttaaggattttgtc
cattatgtacaggggggagaagctcccactccggaaggggaagccctggagatcctgcaa
ggggagcaagtcccggctgttctggacctctttgtggaaaaattaaagagcctggaggca
attcgtgtcgatacggtgaagcctttatttaagcagatcaccaaagaaacgaagctgggc
ggcaaacaagtctttatgcccattcggatcgcactgaccggacagatgcatggaccggag
ctctatgacattgtcccgctgctggggctggagaatgtgctgagccgcttggcggggacg
aaagctttgcttgccggcagccgctaa

DBGET integrated database retrieval system