KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_0467Help
Entry
Dhaf_0467         CDS       T00822                                 

Definition
(RefSeq) acetate/CoA ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dhd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dhaf_0467
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dhaf_0467
   00620 Pyruvate metabolism
    Dhaf_0467
   00640 Propanoate metabolism
    Dhaf_0467
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Dhaf_0467
   00680 Methane metabolism
    Dhaf_0467
Enzymes [BR:dhd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Dhaf_0467
Lipid biosynthesis proteins [BR:dhd01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Dhaf_0467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(503098..505029)
Genome map
AA seq 643 aa AA seqDB search
MEEKNLEALLEEDRQFIPSEEFHKNALIQSADIYEQGQSLGFWEEQAKQLSWLSPWEKTL
EWNPPFAQWFVGGKLNASANCLDRHLQDWHRNKAAIIFEGENGDSQVLTYQDLHREVSKF
ANVLKANGVNKGDRVTIYLPMIPEAVISMLACARIGAPHSVVFGGFSSEALRDRVIDAQA
KAVITSDGSFRRGNTIPLKDNTDIALDGVDCVEHVFVIQRTKQTVQMKEERDLWYHEEMA
KASPVCPAEPMDAEDMLFILYTSGTTGKPKGVVHTTGGYMVGVSTTHRWVFDLKEEDVYW
CTADVGWITGHSYIVYGPLANGATVLMYEGSPDYPNRDRFWEIVEKYKVTILYTAPTAIR
TFMKWGPQYPQSRDLSSLRLLGSVGEPINPEAWMWYYKYIGGERCPIVDTWWQTETGMIM
MTPLPGITSLKPGSCTVPFPGVRIEVVDSAGHPVPKGGGGYLAIKEPWPAMLRNIYGDPA
RFERTYFGNWPGVYFPGDGAKWDKDGYFWILGRVDDVINVSGHRIGTMEVESALVDHPSV
AEAAVIGKNHEVKGQALACFVTLKEGIEITPDLEDELKKHVAKKIGALARPDDIFFTAEL
PKTRSGKIMRRLLRDIAEGRAIGDTTTLADASVVNTLKANYQE
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaagaatcttgaggctttgctggaagaggatagacagttcatccccagtgag
gaattccacaaaaacgcactcattcaaagcgcggatatctatgaacaaggtcaaagcctc
ggcttttgggaggaacaggctaaacaactctcctggttgagcccttgggaaaaaaccctg
gagtggaatcctcccttcgcccagtggtttgtcggcgggaaactcaacgcctccgccaac
tgtctggatcgccacctccaggattggcatcgcaataaagccgctattatcttcgaaggc
gaaaacggggacagccaggttcttacctaccaggatctccatcgtgaagtctccaaattc
gctaatgtcctcaaagccaatggggtgaacaaaggtgatcgggtcaccatctatctgccc
atgattccggaagctgtgatttccatgctggcttgcgcccggattggggctccccacagt
gtggtcttcggaggcttcagttcggaagctttgcgggatcgggtcattgatgctcaggcc
aaagccgtcatcacttccgatggcagcttccgccggggcaacaccatccccttgaaagat
aataccgatatcgctttggacggcgtggactgcgtggaacatgtctttgtcattcaacga
accaaacaaaccgtacaaatgaaggaagagcgggacctttggtatcatgaagaaatggcc
aaggcctccccggtgtgtccggcggagcccatggatgcagaagatatgctctttatcctc
tacaccagcggtaccacaggaaaacccaagggtgtagtccataccacggggggctatatg
gtaggggtatccaccacccatcgctgggtctttgatctcaaggaagaggatgtttactgg
tgcaccgcggatgtgggctggattaccggtcactcctatattgtctacggccccttggcc
aatggagccactgtccttatgtatgagggaagtcctgattatccgaaccgggatcggttc
tgggaaatcgtcgagaaatacaaagtcaccattctttataccgcacccaccgccatccgg
acctttatgaagtggggtccccaatatccccagagccgggatctatccagcctgcgcttg
ctgggctctgtgggtgaacccatcaatccggaagcctggatgtggtactacaaatacatc
ggcggggaacggtgccccatcgtggatacctggtggcaaaccgagacgggtatgattatg
atgacccctctgccgggaattacttccttaaagcccggttcctgtaccgtacctttccca
ggagtcagaatcgaagtggtggacagcgccggccatcccgtccccaagggaggcggcggc
tacctggctatcaaggagccctggcctgctatgctgcgcaatatctacggagatccggcg
cgcttcgagcggacgtacttcggcaactggccgggagtctacttccccggtgatggcgcc
aagtgggataaggacggatatttctggatactgggccgggtggatgatgtcatcaacgtt
tctggtcaccggatcggcaccatggaagtggaaagcgctttagtggatcacccctctgtt
gccgaggctgccgttatcggtaaaaaccatgaagttaaagggcaggccctggcctgtttc
gtcactttaaaggaaggcatcgaaatcactcccgatctggaggacgaattaaagaaacat
gtggcaaagaagatcggagctctggcccggccggatgatatcttctttaccgccgaactg
cccaagacccgcagcggtaagatcatgcgccgcctcctcagagacattgccgagggacgt
gctatcggtgataccaccactttggccgatgcctctgtggtcaatacccttaaagccaat
taccaggagtaa

DBGET integrated database retrieval system