KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_0553Help
Entry
Dhaf_0553         CDS       T00822                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dhd00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
612545..613111
Genome map
AA seq 188 aa AA seqDB search
MQLIEQAKIREAVLMILEAIGEDPEREGLKDTPDRVARMYAEIFSGLAEDAGVYLECVFT
EEHEEMIVVKDIPFYSTCEHHLVPFIGKAHVAYIPAGGKVTGLSKLARVVESIARRPQLQ
ERLTREIADVIMKKLNPQGVAVVVEAEHLCMSMRGIKKPGSKTVTSAVRGLFRKSAKTRA
EFLSLIKT
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgcagttgatagaacaagcaaaaatcagggaagcagtactcatgattttagaagcaatc
ggagaagaccctgagcgggaagggcttaaagatacgcccgaccgggtagccaggatgtat
gctgagatttttagcgggttggcagaagatgcgggagtttatttggaatgtgtatttaca
gaagaacatgaagaaatgatcgtggtaaaggatattcctttttattcgacgtgtgaacat
cacctggttccttttatcggcaaggctcacgtcgcttatattcctgccggcggcaaagtc
accggactcagtaaactggccagagtggtggaaagtatcgccaggcgtccacagcttcag
gagcgcttaacccgggaaattgccgatgtcattatgaaaaagttaaatccccagggagtg
gccgtggttgtagaagctgagcatttatgcatgagtatgcggggcatcaaaaaaccaggc
tccaaaaccgtgacttccgcagtgcggggcctgttcaggaaaagtgccaaaaccagagcg
gaattcttatccttgattaaaacctag

DBGET integrated database retrieval system