KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_0806Help
Entry
Dhaf_0806         CDS       T00822                                 

Definition
hydrogenase (NiFe) small subunit HydA (EC:1.12.99.6)
Orthology
K06282  
hydrogenase small subunit [EC:1.12.99.6]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
Nitrotoluene degradation
Microbial metabolism in diverse environments
Class
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:dhd00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(894895..896022)
Genome map
AA seq 375 aa AA seqDB search
MLNRREFLKLVVKGAILGNFISLVTPELEKALAQGEINKLPIIMVETGTCTGDSISLDNI
WSPTLSDIFTNITEWRYDWTMMQSQGELAYDVLLEIEKNQAHEFVLLVQGSMIRRDGGHY
NYAGLENGQLITGLDLVRRLGLKAKYVVAVGHCATYGGPVAGYPNPTQSTGVQNILPERR
VINVSGCPAHPDWIMGTLLHLALYGEPELEKFGRPKMFFGETIHNNCPRRRYYDQGIFAT
DIGQKECLYRVGCKGPVTYADCPIRRWNDHYNWPIGCNSPCIGCTEPGYPDLMEPFTAHF
PDIPFPGGSRAATDRIGRGVLGLATLGIGGYFLSSFYKGRLHRNFIRSTIKEKKKKIKVK
KVKFCHQYRPKKPKE
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
gtgcttaatcgtcgagaatttcttaagctggtggtcaaaggcgcaattctgggcaacttc
atcagcttagtaacccccgaactggaaaaagccctcgcacaaggagaaatcaataaactt
cccattattatggtggagacaggaacctgtaccggtgacagcatttctttggataatatc
tggtcacccactctatccgatatatttaccaacattactgaatggcgttatgactggacc
atgatgcaatcacaaggggagctggcctacgacgtcttgttggagatcgaaaaaaatcaa
gctcatgagtttgttcttcttgttcaaggttctatgattcgccgggacggaggtcattat
aattacgccggattggaaaacggtcaactgatcaccggtctggatctggtgcgcagactg
gggttaaaagccaaatacgtagtggctgttggccattgcgctacctatgggggacccgtc
gccggttaccctaatcctacacagtctaccggtgtacaaaatattttgcccgagcgccgg
gtgatcaatgtctccggctgccccgcccatccggattggatcatgggaactctccttcac
ttagctctttatggtgagcctgaattggagaaattcggccggccgaaaatgttttttggg
gagactattcataataattgtccccgtcgccgctactacgaccagggcatatttgccaca
gatatcggtcagaaagaatgcctttaccgggtaggctgtaaaggaccggtcacctatgcg
gattgtccgatccgtcgctggaacgatcattataattggcctatagggtgcaattccccc
tgtatcggctgtaccgagcccggttatcctgaccttatggaaccctttaccgcccatttt
cccgatatcccttttccaggaggaagccgggcggcaacggatcgaatcggcaggggggtc
ttgggattagccactctaggaatcggtggttattttttatcttccttttacaagggccgc
cttcatcgcaatttcatcaggtccaccatcaaagaaaagaagaaaaagattaaggtaaaa
aaggttaaattctgtcatcaatatcgcccgaagaaaccaaaggagtga

DBGET integrated database retrieval system