KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_0806Help
Entry
Dhaf_0806         CDS       T00822                                 

Definition
hydrogenase (NiFe) small subunit HydA (EC:1.12.99.6)
Orthology
K06282  
hydrogenase small subunit [EC:1.12.99.6]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
Nitrotoluene degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dhd00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Dhaf_0806
Enzymes [BR:dhd01000]
 1. Oxidoreductases
  1.12  Acting on hydrogen as donor
   1.12.99  With other, unknown, acceptors
    1.12.99.6  hydrogenase (acceptor)
     Dhaf_0806
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(894895..896022)
Genome map
AA seq 375 aa AA seqDB search
MLNRREFLKLVVKGAILGNFISLVTPELEKALAQGEINKLPIIMVETGTCTGDSISLDNI
WSPTLSDIFTNITEWRYDWTMMQSQGELAYDVLLEIEKNQAHEFVLLVQGSMIRRDGGHY
NYAGLENGQLITGLDLVRRLGLKAKYVVAVGHCATYGGPVAGYPNPTQSTGVQNILPERR
VINVSGCPAHPDWIMGTLLHLALYGEPELEKFGRPKMFFGETIHNNCPRRRYYDQGIFAT
DIGQKECLYRVGCKGPVTYADCPIRRWNDHYNWPIGCNSPCIGCTEPGYPDLMEPFTAHF
PDIPFPGGSRAATDRIGRGVLGLATLGIGGYFLSSFYKGRLHRNFIRSTIKEKKKKIKVK
KVKFCHQYRPKKPKE
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
gtgcttaatcgtcgagaatttcttaagctggtggtcaaaggcgcaattctgggcaacttc
atcagcttagtaacccccgaactggaaaaagccctcgcacaaggagaaatcaataaactt
cccattattatggtggagacaggaacctgtaccggtgacagcatttctttggataatatc
tggtcacccactctatccgatatatttaccaacattactgaatggcgttatgactggacc
atgatgcaatcacaaggggagctggcctacgacgtcttgttggagatcgaaaaaaatcaa
gctcatgagtttgttcttcttgttcaaggttctatgattcgccgggacggaggtcattat
aattacgccggattggaaaacggtcaactgatcaccggtctggatctggtgcgcagactg
gggttaaaagccaaatacgtagtggctgttggccattgcgctacctatgggggacccgtc
gccggttaccctaatcctacacagtctaccggtgtacaaaatattttgcccgagcgccgg
gtgatcaatgtctccggctgccccgcccatccggattggatcatgggaactctccttcac
ttagctctttatggtgagcctgaattggagaaattcggccggccgaaaatgttttttggg
gagactattcataataattgtccccgtcgccgctactacgaccagggcatatttgccaca
gatatcggtcagaaagaatgcctttaccgggtaggctgtaaaggaccggtcacctatgcg
gattgtccgatccgtcgctggaacgatcattataattggcctatagggtgcaattccccc
tgtatcggctgtaccgagcccggttatcctgaccttatggaaccctttaccgcccatttt
cccgatatcccttttccaggaggaagccgggcggcaacggatcgaatcggcaggggggtc
ttgggattagccactctaggaatcggtggttattttttatcttccttttacaagggccgc
cttcatcgcaatttcatcaggtccaccatcaaagaaaagaagaaaaagattaaggtaaaa
aaggttaaattctgtcatcaatatcgcccgaagaaaccaaaggagtga

DBGET integrated database retrieval system