KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_0993Help
Entry
Dhaf_0993         CDS       T00822                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dhd00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dhaf_0993
Enzymes [BR:dhd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Dhaf_0993
Peptidases [BR:dhd01002]
 Cysteine Peptidases
  Family C44
   Dhaf_0993
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1078757..1080610)
Genome map
AA seq 617 aa AA seqDB search
MCSILGLVNFKRKISPQEIQCLSTMGKTLIHRGPDQNGLEYGEHFAFQHNRLAIIDIEKG
RQPMTATHQGYDYTIVYNGELYNTADLRQELLEHGVKFKTYCDTEVVLYAYIIWGEQCSS
KLNGIYAFVIYDSKEKKTYLSRDRFGVKPFFYTFVEGALLFASEIKALLKHPQVKPRLDY
QGLWQLLYMMPVKEEGTAIFKDIFELPTASHAFYSLAPGASEAELKIAKYWTMEAYENQD
SEAAIVATTRDLLVDAIERQLVSDVPLCTFLSGGLDSSIITAVAAQKYQAEGRQLATYSF
EHEGNKDHFKQTLFQPQSDDEFAVYLAQHLHTQHQILTAKKEHLVDYLDEAVRYRDYPGM
ADIDSSLLFYCRQVKEHHTVALSGECSDEVFGGYPWFYRPEMLTRGFFPWIHEPHARISL
FKPELVRPQEGFAYTSEIYRRSVEACPLLPDESETMQNSRIASWLSINYFMTSLLERKDR
MSMASGLEVRVPFSDHRLVQYVYNVPWEIKFKDGVEKALLRAAMQDYLPPKILYRKKSPF
PKTHDPHYEELVFHLFRKRLDSGSGMLAELLQKDVLNRLISPGNNTWFGQLMGLPQLLAW
LVQLDYWFEAYQVQLVG
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgtgctccattcttggattagtaaattttaaacggaagatttctccccaggagatacaa
tgccttagcactatggggaagactttaattcatcggggtccggaccaaaacggccttgaa
tacggagaacattttgcttttcaacataaccgtttagccattatcgatattgaaaaaggc
cggcagcccatgaccgccacccatcagggatacgactataccattgtttacaacggcgaa
ctttacaacaccgcagatttacggcaagagctccttgagcacggagttaagttcaaaact
tactgtgatacggaagtagtgctctatgcctatatcatctggggagaacaatgctccagc
aaattaaacggcatttacgcctttgtaatctacgattctaaagaaaaaaagacctatctt
tcccgtgaccgcttcggcgtcaaacccttcttctacacttttgtagagggcgctcttctt
ttcgcttcggagatcaaagccctcctcaagcaccctcaagtgaaaccccgtctggattac
cagggtttatggcagctcctctatatgatgcctgtcaaagaggaaggcaccgccatcttt
aaggatatcttcgaattgcccaccgcctcccatgctttctatagccttgccccaggagca
tctgaagcagagttgaagatcgccaaatactggaccatggaggcttatgagaatcaggac
agcgaagctgctatcgtcgccaccacccgggatctgttggtggatgccattgaacgtcag
ctggtctccgatgtccctctttgcactttcctttccggaggattggattcttcaatcatc
accgccgtggcagcgcaaaaatatcaagccgaaggacggcagcttgctacctattccttt
gaacatgaaggcaataaagaccattttaagcagactcttttccaaccgcaaagtgatgac
gagtttgccgtttatctggctcagcacctgcacacacagcatcagattctgaccgctaaa
aaggagcatttggtggactacctggatgaagccgtaaggtatagggactatcccggcatg
gcagatatcgattcctccctgctcttttattgccgtcaggtaaaagaacaccacacggtg
gctttatccggagaatgctctgatgaagtcttcgggggctacccctggttttatcgtccg
gaaatgctcacacgggggtttttcccttggatccacgaaccccatgcccggattagtctg
ttcaagcctgaactggttcgcccccaggagggctttgcgtacacttcggagatttaccgc
cggagcgtcgaggcctgccccttgcttccagatgagtcggagactatgcagaactcccgc
atcgccagctggctttccattaattactttatgacctccttgctggaacgcaaagatcgc
atgagcatggcttcgggcttggaagtccgggttcctttctccgatcaccgcttggttcag
tacgtctataatgtgccatgggagattaaattcaaggatggcgtcgaaaaggcactgctt
cgggccgccatgcaggactatctgcctcctaaaatcctctatcgtaaaaaaagccccttc
cctaaaacccatgatcctcattatgaagagctggtattccatcttttccggaagcggctg
gactccggcagcggcatgctggcagagctattgcaaaaggatgtgctcaatcgccttata
agtcctggaaataacacctggtttggccagttgatggggcttccgcaattgctggcttgg
ctggtgcagctggactattggtttgaagcctaccaggtgcaattggtaggctaa

DBGET integrated database retrieval system