KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_1203Help
Entry
Dhaf_1203         CDS       T00822                                 

Definition
phosphonate ABC transporter substrate-binding protein
Orthology
K02044  
phosphonate transport system substrate-binding protein
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
ABC transporters
Brite
KEGG Orthology (KO) [BR:dhd00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Dhaf_1203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1299063..1300052
Genome map
AA seq 329 aa AA seqDB search
MGIDEMKFMNPQNHGQCFLRFLLLIILSFSMLTGCSSQGEEAIDIDLANRSYNEARSNSP
EISDAIYFGFDRRLETKEDVKMYVPLLNYLRKETGYRFEIHVTPVNSSVVEELGQGKIQM
AAIGTLGYLQASETFGAIITVKGLNNEDKDMYKAAIVTRPNSQIKVISDIRGRSFAFGDL
ASTQGHLIPRIMLSQKGIEIISLKYYQNFASHSEVANAVMSGRFEAGGMQDTLAKSLEDA
GLLKIIAVSEEYPSSGIAFAKGVDKDVIDKITQALVKFDPEGEDKAGLYHWERSEMPHGF
TYANNEDYNVLRNWADKFGLLKKMDGESK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
ttgggtattgatgaaatgaaatttatgaatccacagaatcatggccagtgctttttacgt
tttttgctactaatcattctttctttttcaatgcttacaggctgcagtagccaaggagaa
gaggctatcgatattgatttagccaaccgttcttataatgaagcccgatctaattccccc
gaaatatccgatgctatttattttggctttgacagaagattagagactaaagaagatgta
aagatgtatgttccactattaaattacttaagaaaagaaactggatatcgatttgagatc
catgttactcctgtcaactcaagtgttgttgaggagttaggacaaggaaaaattcaaatg
gcagcaattggaacactagggtatttacaagcttctgaaacttttggtgcaattattacc
gttaaaggacttaataatgaagacaaggatatgtataaagctgcgattgtgacccgtcct
aatagtcaaataaaggtgatatcagacataagggggagatcttttgctttcggcgatctt
gcatctacccaaggacacttaataccgagaatcatgttatcgcaaaaggggatagaaatt
atttcgcttaagtattatcaaaatttcgcctctcattctgaagtcgcaaatgcagttatg
agtggccgatttgaagctggcggtatgcaagatacattggcaaaatctcttgaggacgcc
ggtttattgaaaattatcgctgtttcagaggaatatccaagtagtggtatcgcttttgct
aaaggagtagataaagatgttattgataaaattactcaggcattagtaaagttcgatccc
gaaggggaagataaggcaggcctttaccattgggaaaggtctgaaatgccacatggtttc
acctatgccaacaatgaggactataacgtattaagaaactgggccgataaatttggttta
ttaaaaaaaatggatggtgaaagcaagtga

DBGET integrated database retrieval system