KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_1244Help
Entry
Dhaf_1244         CDS       T00822                                 

Definition
(GenBank) acetaldehyde dehydrogenase (acetylating)
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
dhd00360  Phenylalanine metabolism
dhd00362  Benzoate degradation
dhd00620  Pyruvate metabolism
dhd00621  Dioxin degradation
dhd00622  Xylene degradation
dhd00650  Butanoate metabolism
dhd01100  Metabolic pathways
dhd01120  Microbial metabolism in diverse environments
dhd01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dhd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dhaf_1244
   00650 Butanoate metabolism
    Dhaf_1244
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Dhaf_1244
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Dhaf_1244
   00622 Xylene degradation
    Dhaf_1244
   00621 Dioxin degradation
    Dhaf_1244
Enzymes [BR:dhd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Dhaf_1244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh NAD_binding_3 GFO_IDH_MocA Spore_GerAC
Motif
Other DBs
NCBI-ProteinID: ACL19301
JGI: Dhaf1244
UniProt: B8G186
Position
1339202..1340095
Genome map
AA seq 297 aa AA seqDB search
MGKQRLNAAIIGPGNIGTDLMYKILRRSEYLELKLVAGIVAESEGLRLAREEGVATSAAG
IQAILDRKDIDIVFDATTAHAHAQHAPLLKDAGIIAVDLTPAAVGPYVMPVVNLEEHIDA
MNVNLITCGGQATIPIVYAISRVVPTAYAEIVATIASKSAGPGTRQNIDEFTLTTAKGIV
DIGNAQKGKAIILLNPADPPMMMNNTIYALIDQVDPAIEQKITESVEEIIKEVQAFVPGY
KLKIPPMFDGNKVTVMIEVEGSGDYLPQYSGNLDLETCAALAVAEKMAKHKLAAGAN
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaacagagattaaacgctgccattatcggtccgggcaatatcggtacggatctg
atgtataaaattctgagaagatccgagtatttggaactgaaactggttgccggcattgtt
gccgaatccgaggggctgcgcctggccagggaagaaggcgttgcgacgagcgctgcaggg
atccaggctattctggacagaaaggatattgatatcgtttttgatgcgaccaccgcccac
gcccatgcacagcatgcacccttgctgaaggacgccggaattatcgcagtcgatctgacg
cctgcggcagtggggccctatgtgatgcccgtggttaatctggaggagcatatcgacgcc
atgaacgttaatttaatcacttgcggcgggcaggccacgatccccattgtttatgcgatc
agcagggtggtccctaccgcttatgccgagattgtggcgacgattgccagtaaaagcgcc
ggacccgggacccggcagaatattgatgagtttacgctgaccacggctaaaggtattgtg
gatattggcaatgctcaaaaaggcaaggcgattattttgctcaatccggccgatccgccg
atgatgatgaacaatacgatttatgccttgatcgaccaggtcgacccagccatcgagcaa
aagatcacagaatcggtggaagaaataattaaagaagtccaagcctttgttcccggttat
aaactgaaaatcccgccgatgtttgacggcaacaaagtaaccgttatgatcgaggtcgaa
ggttccggagattatttgccccagtacagcggcaatttggacttggaaacctgtgcggca
ttggccgtggctgagaaaatggccaagcacaaattggctgcgggtgcaaattag

DBGET integrated database retrieval system