KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_1244Help
Entry
Dhaf_1244         CDS       T00822                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dhd00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:dhd00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:dhd00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:dhd00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:dhd00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1339202..1340095
Genome map
AA seq 297 aa AA seqDB search
MGKQRLNAAIIGPGNIGTDLMYKILRRSEYLELKLVAGIVAESEGLRLAREEGVATSAAG
IQAILDRKDIDIVFDATTAHAHAQHAPLLKDAGIIAVDLTPAAVGPYVMPVVNLEEHIDA
MNVNLITCGGQATIPIVYAISRVVPTAYAEIVATIASKSAGPGTRQNIDEFTLTTAKGIV
DIGNAQKGKAIILLNPADPPMMMNNTIYALIDQVDPAIEQKITESVEEIIKEVQAFVPGY
KLKIPPMFDGNKVTVMIEVEGSGDYLPQYSGNLDLETCAALAVAEKMAKHKLAAGAN
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaacagagattaaacgctgccattatcggtccgggcaatatcggtacggatctg
atgtataaaattctgagaagatccgagtatttggaactgaaactggttgccggcattgtt
gccgaatccgaggggctgcgcctggccagggaagaaggcgttgcgacgagcgctgcaggg
atccaggctattctggacagaaaggatattgatatcgtttttgatgcgaccaccgcccac
gcccatgcacagcatgcacccttgctgaaggacgccggaattatcgcagtcgatctgacg
cctgcggcagtggggccctatgtgatgcccgtggttaatctggaggagcatatcgacgcc
atgaacgttaatttaatcacttgcggcgggcaggccacgatccccattgtttatgcgatc
agcagggtggtccctaccgcttatgccgagattgtggcgacgattgccagtaaaagcgcc
ggacccgggacccggcagaatattgatgagtttacgctgaccacggctaaaggtattgtg
gatattggcaatgctcaaaaaggcaaggcgattattttgctcaatccggccgatccgccg
atgatgatgaacaatacgatttatgccttgatcgaccaggtcgacccagccatcgagcaa
aagatcacagaatcggtggaagaaataattaaagaagtccaagcctttgttcccggttat
aaactgaaaatcccgccgatgtttgacggcaacaaagtaaccgttatgatcgaggtcgaa
ggttccggagattatttgccccagtacagcggcaatttggacttggaaacctgtgcggca
ttggccgtggctgagaaaatggccaagcacaaattggctgcgggtgcaaattag

DBGET integrated database retrieval system