KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_1492Help
Entry
Dhaf_1492         CDS       T00822                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dhd01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:dhd00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1588043..1589323
Genome map
AA seq 426 aa AA seqDB search
MEIKTLEELDLTMLTRKSYGDDQLLEHKVAEILSEIKKEGDSALYALTEKFDGVDLRPSG
LRVRAEELVKAYSQVDEEFLAALRLAKEKITSYHEKQKRTSWLDAQEDGSILGQLLLPLK
RVGIYVPGGTAAYPSSVLMNAVPAVVAGVEEIVMVSPPRKDGSLLPEVLVAAAEAGVTEI
YKVGGAQAIAALAFGTGEISPVDKITGPGNIYVTLAKKQVFGTVDIDMLAGPSEILILAD
ESAQPEELAADLLSQAEHDPLASSILVSPDRKVLEETVAEVERQLKLLPRQDIARASWET
YGAAILVKDLAEGMNLVNQIAPEHFELVIKEPYSWLGRVRNAGAVFLGRFSPEPVGDYFA
GPNHVLPTGGTARFYSPLNVDTFMKKVSVISYSEKALQRDGKHIAHLARKEGLEAHARAV
EARKLW
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggagattaagacccttgaggaattggatttgactatgcttacgcgcaaatcctatggc
gatgatcaattgctggaacataaggtagcggaaattctttctgagattaagaaagaaggg
gattcagccctctatgccttaacggaaaaatttgatggagtggatctccgcccatccggg
ctgcgcgttcgagcagaagaactagtgaaggcatactctcaggtggatgaagaattcctg
gcagctctgcggcttgctaaggagaagatcacctcttaccacgaaaagcaaaaacgcacc
tcatggttggatgcccaggaagacggcagtattctggggcagctgttgctaccccttaaa
cgggttggcatctatgtaccggggggaaccgctgcttatccttcttcagtgctgatgaat
gcagtccccgctgtagtagcaggggtcgaagagatcgtgatggtcagtccgccgcgcaag
gatggcagcttgctgccggaggtcctggtagccgccgcggaagccggagtcacggaaatc
tataaggtaggaggggctcaggccattgccgccttagcctttggcacaggggaaatctct
cctgtggataaaatcaccggaccggggaacatttatgtcaccctggccaaaaaacaggtc
tttggcaccgtggatattgatatgctggccggtcccagtgagatactcattttagccgat
gagtccgcgcagccggaagagcttgccgccgatctgctttcccaggctgagcatgatccc
ttggcttcctccattttggtctctcctgatcggaaagtgctggaggagacggtggcggaa
gtggagcgtcaattaaagctgctgccacggcaggatatcgcccgagcctcatgggagacc
tatggggcggcgattttggttaaggatctggctgagggcatgaatttagtcaaccagata
gctcccgaacattttgaactggtgattaaggaaccctatagctggctgggccgggtaaga
aatgccggagctgtctttttgggccgtttctcaccggaacctgtaggcgattattttgcc
ggccccaatcatgtattgcctacgggaggtacggcccgcttttattctccgttaaatgtg
gatacctttatgaagaaagtcagtgtgatcagttattcggaaaaggccctgcagcgggac
ggcaagcacatcgctcatttagcccggaaagagggactcgaagcccatgcccgggctgtg
gaggccaggaagctatggtag

DBGET integrated database retrieval system