KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_2056Help
Entry
Dhaf_2056         CDS       T00822                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
dhd00030  Pentose phosphate pathway
dhd01100  Metabolic pathways
dhd01120  Microbial metabolism in diverse environments
dhd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dhd00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Dhaf_2056
Enzymes [BR:dhd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Dhaf_2056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ACL20093
JGI: Dhaf2056
UniProt: B8FRV5
Position
2217705..2219507
Genome map
AA seq 600 aa AA seqDB search
MVFTHRIMEVNLTTQTHGQYAIDPKWARDFIGGRGLGIRLLWERTPKGIDPLAPEAELYL
LTGPLTGIAPGGAHTCLVFKSPQTNTLNYSITGAQWGQELRAAGWEGLMITGRSERPVYL
LIEDGAVQFRDASHLWGLTTFAAERQLREELKDSRVRILNIGPAGEEMIPYASIQQEMFR
SAARGGSGAVWGSKNLKAVAVRGTMALPVHNPSQAIPIRNEMEKILKDSRTTIRRTYDLM
RWGGSMTNMPHSDEGHLDVANYREGHWPEINKIGGLAYERLCRARSRGCFGCPMGCMPLG
VVREGEFSGNVVCPDLEAAATMGSGILVNDLNAMVYLTRWADEYGFDSTSLGNITGFAME
CYENGLLPEAELEGIDLSWGNVEGVLALWNKILKREGIGALFAEGVKKAAAKIGGGSEHY
AMQVKGREFACFTPQADHKQGLQYAVSDKGPAHHFGGKADHTQQRTWADLLTACTWQRRM
IKPEVYLKLLNAVTDWQLQAGDWPLTARRILLLARAYNIREGLLPLRDDVPPERVHVDKL
TTGIGAGQVYPREQFSMDRKAWYGELGCDAGGFPTPEALKEHGLEFAVPVVESSRRDSVQ
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atggtttttacgcaccggatcatggaagtgaatctgaccacacaaacccatggacaatat
gccatagatccgaagtgggcccgggattttattggcgggcgcggcttgggaatccgcttg
ctgtgggagaggacacctaagggaatcgatcctttggcaccggaagccgagctctatttg
ttaaccgggcctcttaccggcatagcgcccgggggagcccatacctgcctcgtgttcaag
tcccctcagaccaacaccctgaattactcgatcaccggagcacagtggggtcaggaactc
cgagcggcggggtgggaaggtctgatgatcaccggcagatcggaaagaccggtctatctt
ctgatcgaagacggtgccgttcagttccgggatgcctcacacctatggggactgaccacc
ttcgcagcggaaagacagttaagagaagaactgaaagacagccgggtgaggatactgaac
atcggccccgcgggagaggagatgattccttatgcttcaatacagcaggagatgtttcgt
tcggccgccaggggcggcagcggggcggtctgggggtcgaagaatttaaaggcggttgcc
gtgaggggaaccatggcccttcctgtacataatccgtcccaggccattccgattagaaat
gaaatggaaaaaatactcaaagacagccggacaaccataaggcgcacctatgatctgatg
cgctgggggggcagcatgaccaatatgccccattctgatgaagggcatctggatgtggcc
aattaccgggaaggacattggccggagatcaacaagatcggcggactggcctacgaaagg
ctgtgccgcgccagatcgagggggtgttttggctgcccaatgggctgtatgcctttgggc
gtggtgcgggaaggggaattttcaggaaatgtggtctgcccggatcttgaagcagcggct
accatggggtcgggaattctggtcaatgatttgaatgctatggtatacctgacgcgctgg
gcggacgagtatggctttgacagtacctctctcggcaacatcaccggctttgctatggag
tgttatgaaaacgggttgcttcctgaggcagaacttgaggggattgatctcagctggggg
aatgtggaaggcgtccttgctctttggaacaagattcttaagcgggaaggcatcggagcc
ctcttcgcggaaggggtaaaaaaggctgccgcaaagatcggcggcggctccgagcattat
gccatgcaggtgaagggacgtgaatttgcctgttttacaccccaggccgatcataagcag
gggttgcaatatgccgtttccgataaggggcctgcccatcatttcggaggaaaagcggat
catacccaacagcggacctgggcagacctgttgacggcctgcacctggcaaaggcggatg
attaaaccggaggtttatctgaagctgctgaatgccgtgacggactggcagttgcaggcc
ggggactggccattgaccgctaggcggattttgctgctggcccgggcttataacattcgg
gaagggttgcttcctttacgtgacgatgtcccgccggaaagagttcacgtggacaaactg
actacggggattggagcaggccaggtatacccgcgggagcagttttccatggacagaaaa
gcatggtatggagagctgggctgtgatgccggaggatttccgaccccggaggcccttaag
gagcacgggctggagtttgccgtacctgttgtggagagttcccgccgggactcggtccaa
tga

DBGET integrated database retrieval system