KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_2065Help
Entry
Dhaf_2065         CDS       T00822                                 

Definition
succinate--CoA ligase (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dhd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dhaf_2065
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dhaf_2065
   00640 Propanoate metabolism
    Dhaf_2065
   00660 C5-Branched dibasic acid metabolism
    Dhaf_2065
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Dhaf_2065
Enzymes [BR:dhd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Dhaf_2065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2227718..2228890
Genome map
AA seq 390 aa AA seqDB search
MYLYEYEAKEVFSKYGIPLGQNGIATNPAEAGMICAGIGKPVVVKAQVMAGGRGKAGLIL
PAADPEAAAKAAAQILGKEHHGEQVKKLLIEEQIEIAREVYASITMDFTEGKPVMMVSAQ
GGMEIESLAAANPELLIKEHIDPWREVFGHRLRDLWRRAGFRGGQVVELENILGRLVRVF
LETDALTAEINPLVMTQEGKIIAADAKLILDDEASFRSEIIRNASRPEINPLEKRAGDLN
VTYVSIEEGGDIGIIAGGAGLSMATMDAVYGIGAKPAAFIDLGGGISRERMKESLLLMTE
TPNLRGIIINVFGGINNCLTMAAGLADFLDEKPTDVKIVVKMRGHEQEEGWRILERYGIP
TVKFETTDVAIRLLMQVLAKEVTAGGTHHQ
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgtacctttatgaatatgaagccaaagaggtttttagtaagtatggcataccccttggg
caaaacggcatagctaccaaccctgctgaagccggaatgatctgtgccggaatcggcaaa
ccggttgtagtaaaagcgcaggtcatggcaggcgggcgtggcaaagcgggattaattctt
ccggcagctgaccctgaagcagccgcaaaggcagcggcccaaattttgggcaaggagcac
catggcgagcaagtcaaaaagctgttgatagaagagcagattgagattgcccgggaggtt
tatgccagcattaccatggactttactgaagggaaacccgttatgatggtatcggcccaa
ggcgggatggaaattgagagcttggcggcagccaacccggagctgctgatcaaagagcat
atcgatccctggcgggaggtgttcggccaccggttaagggatttgtggcgcagagcaggc
tttcgcggcggacaggttgttgaattggagaatattttaggcaggctggtaagggttttt
ctggaaacggacgctctgaccgcagaaataaatccgctggtgatgacacaggagggaaag
atcatagcggcggatgccaaattgatcctggacgatgaagcttctttccgcagtgaaatc
atcaggaatgcttcccgcccggagatcaatccactggaaaagagggccggggatttaaat
gtgacttatgtgagcattgaggaagggggagatatcggaattatcgccgggggagccggg
ctatccatggcgaccatggatgcggtctatgggatcggggccaagccggccgctttcatc
gatcttggcggcgggatatcccgggaaagaatgaaagaaagcctgcttttgatgacggag
accccgaatctgcgggggatcatcatcaatgtattcggcgggatcaataattgcctgacc
atggccgcggggctggcggattttctggatgaaaagccaaccgatgttaaaattgttgtc
aaaatgcggggacatgaacaggaagaaggctggcggatcttggagcggtatggtattccg
acggttaaattcgagacgactgatgtagcaatcaggctgttaatgcaagtgttggcgaag
gaggtgacggccggtgggactcatcatcaataa

DBGET integrated database retrieval system