KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_2414Help
Entry
Dhaf_2414         CDS       T00822                                 

Definition
acetyl-CoA carboxylase carboxyltransferase subunit alpha (EC:6.4.1.2)
Orthology
K01962  
acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dhd01200]
Metabolism; Overview; Fatty acid metabolism [PATH:dhd01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dhd00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dhd00640]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:dhd00720]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:dhd00061]
Metabolism; Metabolism of terpenoids and polyketides; Tetracycline biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2606597..2607556
Genome map
AA seq 319 aa AA seqDB search
MAQHFDFEKPILELEQKIAELQEFSKEKDINLSPEISKLMRRLVRLRKEIYGNLEPWQKV
QIARHMERPNFYDYAPLLFEDFMEFKGDRLFADDKAIVGGIAIFQGIPVTVVSHIKGRGT
KENIQRNFGMPHPEGYRKALRLMDQAEKFHRPILTFIDTPGAACDLEAEERGQGEAIARC
LQAMAGYSVPIICTVIGEGGSGGALALGVGNKVLLLENSFYSVIAPESCASILWKDPGKA
KEAASALKFTAQDLLELGIADGIIKEPLGGAHRSVERTAEEMKKTIAEALAELRELPPDE
LRTMRYEKLMNYGEFEEKA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggctcaacattttgattttgaaaagccaattcttgagcttgaacagaagatcgcggag
ctgcaggaattctccaaagagaaggatatcaatctttcgccggaaatctccaagctcatg
cgcagactggtacgattaagaaaagaaatttacggcaacctggaaccttggcaaaaggtt
cagattgcccgccatatggaacgaccgaatttttacgattatgcccctctgctttttgag
gattttatggagttcaaaggggatcgtctctttgccgacgacaaggctatcgtcggcggt
atcgccatctttcaagggattcccgtcacggtggtttcccatatcaaagggagagggact
aaggagaatattcagcgaaactttggcatgccccatccggaaggataccggaaggctctc
cgcctgatggatcaggcggaaaaattccaccgccccatcctcacctttatcgatactccc
ggtgcggcttgtgatcttgaagcggaggaacgggggcagggggaagccattgcccgctgc
ttacaggccatggctgggtacagcgttccgattatttgcaccgtgatcggggagggaggc
agcggcggcgccttggccttaggtgtggggaacaaggtcttgctgctggagaattccttc
tactcggtcattgctccggaaagctgtgcgtcaattctctggaaggatccgggcaaagcg
aaggaagcggcttccgctttaaaattcaccgcccaggatctcctggagctgggaatcgcc
gacggcattatcaaggaacccctgggaggagcccaccggagtgtggagcggaccgccgag
gaaatgaagaaaaccattgccgaagccctggcggaacttcgagaactcccaccggatgag
ctgcgaactatgcgttatgaaaaacttatgaactacggagaatttgaagagaaggcttga

DBGET integrated database retrieval system