KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_2414Help
Entry
Dhaf_2414         CDS       T00822                                 

Definition
acetyl-CoA carboxylase carboxyltransferase subunit alpha (EC:6.4.1.2)
Orthology
K01962  
acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:dhd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dhaf_2414
   01212 Fatty acid metabolism
    Dhaf_2414
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dhaf_2414
   00640 Propanoate metabolism
    Dhaf_2414
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Dhaf_2414
  Lipid metabolism
   00061 Fatty acid biosynthesis
    Dhaf_2414
  Metabolism of terpenoids and polyketides
   00253 Tetracycline biosynthesis
    Dhaf_2414
Enzymes [BR:dhd01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Dhaf_2414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2606597..2607556
Genome map
AA seq 319 aa AA seqDB search
MAQHFDFEKPILELEQKIAELQEFSKEKDINLSPEISKLMRRLVRLRKEIYGNLEPWQKV
QIARHMERPNFYDYAPLLFEDFMEFKGDRLFADDKAIVGGIAIFQGIPVTVVSHIKGRGT
KENIQRNFGMPHPEGYRKALRLMDQAEKFHRPILTFIDTPGAACDLEAEERGQGEAIARC
LQAMAGYSVPIICTVIGEGGSGGALALGVGNKVLLLENSFYSVIAPESCASILWKDPGKA
KEAASALKFTAQDLLELGIADGIIKEPLGGAHRSVERTAEEMKKTIAEALAELRELPPDE
LRTMRYEKLMNYGEFEEKA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggctcaacattttgattttgaaaagccaattcttgagcttgaacagaagatcgcggag
ctgcaggaattctccaaagagaaggatatcaatctttcgccggaaatctccaagctcatg
cgcagactggtacgattaagaaaagaaatttacggcaacctggaaccttggcaaaaggtt
cagattgcccgccatatggaacgaccgaatttttacgattatgcccctctgctttttgag
gattttatggagttcaaaggggatcgtctctttgccgacgacaaggctatcgtcggcggt
atcgccatctttcaagggattcccgtcacggtggtttcccatatcaaagggagagggact
aaggagaatattcagcgaaactttggcatgccccatccggaaggataccggaaggctctc
cgcctgatggatcaggcggaaaaattccaccgccccatcctcacctttatcgatactccc
ggtgcggcttgtgatcttgaagcggaggaacgggggcagggggaagccattgcccgctgc
ttacaggccatggctgggtacagcgttccgattatttgcaccgtgatcggggagggaggc
agcggcggcgccttggccttaggtgtggggaacaaggtcttgctgctggagaattccttc
tactcggtcattgctccggaaagctgtgcgtcaattctctggaaggatccgggcaaagcg
aaggaagcggcttccgctttaaaattcaccgcccaggatctcctggagctgggaatcgcc
gacggcattatcaaggaacccctgggaggagcccaccggagtgtggagcggaccgccgag
gaaatgaagaaaaccattgccgaagccctggcggaacttcgagaactcccaccggatgag
ctgcgaactatgcgttatgaaaaacttatgaactacggagaatttgaagagaaggcttga

DBGET integrated database retrieval system