KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_2529Help
Entry
Dhaf_2529         CDS       T00822                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dhd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dhaf_2529
   01230 Biosynthesis of amino acids
    Dhaf_2529
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dhaf_2529
   00030 Pentose phosphate pathway
    Dhaf_2529
   00051 Fructose and mannose metabolism
    Dhaf_2529
   00052 Galactose metabolism
    Dhaf_2529
  Energy metabolism
   00680 Methane metabolism
    Dhaf_2529
Enzymes [BR:dhd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dhaf_2529
Protein phosphatases and associated proteins [BR:dhd01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dhaf_2529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2733574..2734695
Genome map
AA seq 373 aa AA seqDB search
MEPIKGEQRDGQSEIRKLAILTGGGDCPGLNAVIRAAVKTACHRGIAVVGIQDGFRGAVE
GDFRPLELKDVSGILPRGGTILGTTNRDNPFAYPTQVGEERQVQDRSAEVLDRFKAEGID
ALIAIGGDGSLSIAWEFAKQGLKVVGVPKTIDNDLMCTDLTFGFQTAVATAQDALDRLHT
TAESHHRIMILEVMGRYAGWIALYAGVAGGADVILIPEIPYQLESIAEAVQRRARLGKHF
SIIVVAEGAKPLGGDMVVERTMSGRTDPIKLGGIGAKLAADLEKVTDMETRVTVLGHLQR
GGSPIAVDRVLSTRYGVAAVEAALAGDFGMMVALQGQDIVRVPMAEAVHKLKQVEPDDPV
LNAARSMGIEFGD
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggaaccaatcaaaggagagcagcgggatggtcaatctgaaatcaggaagctggcgatc
ttgaccgggggcggagactgcccggggttgaatgcggtgattcgtgccgctgtaaaaaca
gcttgtcatcgcggtatagcggtggtgggaattcaagatggttttcggggagctgtggaa
ggggatttccgtcccttagagcttaaggatgtctccgggatcttaccccggggaggaacg
attctgggcaccaccaaccgggataatccctttgcctatcctacacaagtcggggaagaa
cggcaggttcaggatcgttccgctgaagtgctggacagatttaaagcggaaggaattgat
gccctgattgcgattgggggtgatgggagcttaagcatcgcttgggaatttgctaagcaa
gggcttaaggtggtgggtgttcccaaaaccatcgataatgatctgatgtgcacggattta
acctttggctttcagactgctgtggctactgcccaggacgctttggaccggctccacacc
acggctgaatcccaccaccgcattatgatcttagaggtcatgggacgctacgccggttgg
atcgccctctatgccggagtggcagggggagcggatgtcatcttaatcccggaaattcct
tatcagctggagagtatcgctgaagctgtccagagacgggcccgtttaggcaagcacttc
agcatcattgtggtggctgaaggggctaaacccctgggcggagacatggttgtggaacgc
actatgtcagggagaacagatcccattaaattaggaggaatcggtgcaaagctggcggcg
gatttagagaaggtcaccgatatggagaccagggtgactgtgctgggacatttgcagcgg
ggagggtctcccatcgctgtggatcgggtgctgtccacacgctatggggtggctgccgtt
gaagccgctttggctggtgattttggcatgatggtcgccctgcaggggcaagacatcgtc
agagtgccaatggcagaagccgttcacaagctgaagcaggtggaacctgacgatcctgtc
ttaaatgccgcccgcagcatggggatcgaattcggggactaa

DBGET integrated database retrieval system