KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_2633Help
Entry
Dhaf_2633         CDS       T00822                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dhd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dhaf_2633
   01230 Biosynthesis of amino acids
    Dhaf_2633
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dhaf_2633
   00030 Pentose phosphate pathway
    Dhaf_2633
   00051 Fructose and mannose metabolism
    Dhaf_2633
   00052 Galactose metabolism
    Dhaf_2633
  Energy metabolism
   00680 Methane metabolism
    Dhaf_2633
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Dhaf_2633
Enzymes [BR:dhd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dhaf_2633
Protein phosphatases and associated proteins [BR:dhd01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dhaf_2633
Messenger RNA biogenesis [BR:dhd03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Dhaf_2633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2835857..2837065
Genome map
AA seq 402 aa AA seqDB search
MKANIAIVQAGGPTSVLNASLAGFLEAAASSERYHHVLGFCNGIEGLIKNQVMHLEGLSK
AQLDALKSQPGAVLGAGRYPLTPERLSKVCCNLQLREISQLVLVGGNGTMWAADQIAEAC
PDVQVVGIPKTVDNDLWGTDHSPGYLSAAKFIGEAVRSLALDLWAMRNFERVRVVEVMGR
NVGWLAAAGSLAQTSLPDYPPLHFYLPEHPFELEKFFTKVDEHLHRHPCLLVIVSEGIRL
ADGSPVAEFEIGRCKVPGGAAQMLSSELRNRGIPSRSEVLGILQRANTWSVCERDRQEAI
FLGKQAIGVLGQGKSKVMLGLPAQTVDFAEDSKAQWVDLKSVAGLERPVAPCYLTESGID
PSFTAWLQNKMGEPLAEANSALQVWKLAAEQLSSNPVNRQSR
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcaaatatagctattgtccaggctggtggacccacctctgtgctgaatgcgagc
ttggcgggttttttagaggctgcagcctcttcagagcgatatcatcatgttctaggcttt
tgtaacgggatcgaaggcttgattaagaatcaagtgatgcatttagaaggccttagtaag
gcacagttagatgctcttaaatcccagcctggagctgttttgggggcgggacgatacccg
ctgacaccagaaagattgtcaaaggtatgctgcaatctgcagctgcgagaaataagtcag
ttggttttagtgggcggtaacgggacgatgtgggctgccgaccaaattgccgaagcctgc
ccggatgttcaagttgtcgggataccgaaaacagtggataacgatctttggggaacagat
cattccccaggctatctgagtgccgccaaattcattggcgaagccgttcgctctttggct
ttagatctctgggcaatgcgtaactttgagcgtgtacgggttgttgaggtgatggggcgg
aatgtcgggtggttggctgcggcagggagcttggcgcaaacctctttacctgattacccg
ccgctccatttttacctgccggaacatccctttgagttagaaaagtttttcactaaagtc
gatgaacatttacatcgccatccttgcttgttggttattgtcagcgaagggattcgcttg
gcagatggaagcccggttgccgaatttgagataggccgatgcaaggtaccgggaggggct
gcgcagatgttgtcgtctgaactgcgtaaccgggggattccatcccgaagcgaagttttg
ggaatcttgcagcgggcaaacacttggtctgtgtgtgaacgtgaccgccaggaagctata
tttttagggaagcaggctatcggggtcttaggccagggtaagagcaaagtcatgctgggc
ttgccggcgcagactgttgattttgccgaagacagcaaggcacagtgggttgatctgaaa
agtgttgcaggattggaacgcccagtggctccttgttatttgacagagagcggaattgat
ccttcgtttactgcttggctgcaaaacaaaatgggagaacctttggcggaggccaatagc
gctcttcaggtatggaagcttgctgcggaacaattgtcaagtaaccctgtgaaccgccaa
tccagatag

DBGET integrated database retrieval system