KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_2633Help
Entry
Dhaf_2633         CDS       T00822                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
dhd00010  Glycolysis / Gluconeogenesis
dhd00030  Pentose phosphate pathway
dhd00051  Fructose and mannose metabolism
dhd00052  Galactose metabolism
dhd00680  Methane metabolism
dhd01100  Metabolic pathways
dhd01110  Biosynthesis of secondary metabolites
dhd01120  Microbial metabolism in diverse environments
dhd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dhd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dhaf_2633
   00030 Pentose phosphate pathway
    Dhaf_2633
   00051 Fructose and mannose metabolism
    Dhaf_2633
   00052 Galactose metabolism
    Dhaf_2633
  Energy metabolism
   00680 Methane metabolism
    Dhaf_2633
Enzymes [BR:dhd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dhaf_2633
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Dhaf_2633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ACL20659
JGI: Dhaf2633
UniProt: B8FVF0
Position
2835857..2837065
Genome map
AA seq 402 aa AA seqDB search
MKANIAIVQAGGPTSVLNASLAGFLEAAASSERYHHVLGFCNGIEGLIKNQVMHLEGLSK
AQLDALKSQPGAVLGAGRYPLTPERLSKVCCNLQLREISQLVLVGGNGTMWAADQIAEAC
PDVQVVGIPKTVDNDLWGTDHSPGYLSAAKFIGEAVRSLALDLWAMRNFERVRVVEVMGR
NVGWLAAAGSLAQTSLPDYPPLHFYLPEHPFELEKFFTKVDEHLHRHPCLLVIVSEGIRL
ADGSPVAEFEIGRCKVPGGAAQMLSSELRNRGIPSRSEVLGILQRANTWSVCERDRQEAI
FLGKQAIGVLGQGKSKVMLGLPAQTVDFAEDSKAQWVDLKSVAGLERPVAPCYLTESGID
PSFTAWLQNKMGEPLAEANSALQVWKLAAEQLSSNPVNRQSR
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcaaatatagctattgtccaggctggtggacccacctctgtgctgaatgcgagc
ttggcgggttttttagaggctgcagcctcttcagagcgatatcatcatgttctaggcttt
tgtaacgggatcgaaggcttgattaagaatcaagtgatgcatttagaaggccttagtaag
gcacagttagatgctcttaaatcccagcctggagctgttttgggggcgggacgatacccg
ctgacaccagaaagattgtcaaaggtatgctgcaatctgcagctgcgagaaataagtcag
ttggttttagtgggcggtaacgggacgatgtgggctgccgaccaaattgccgaagcctgc
ccggatgttcaagttgtcgggataccgaaaacagtggataacgatctttggggaacagat
cattccccaggctatctgagtgccgccaaattcattggcgaagccgttcgctctttggct
ttagatctctgggcaatgcgtaactttgagcgtgtacgggttgttgaggtgatggggcgg
aatgtcgggtggttggctgcggcagggagcttggcgcaaacctctttacctgattacccg
ccgctccatttttacctgccggaacatccctttgagttagaaaagtttttcactaaagtc
gatgaacatttacatcgccatccttgcttgttggttattgtcagcgaagggattcgcttg
gcagatggaagcccggttgccgaatttgagataggccgatgcaaggtaccgggaggggct
gcgcagatgttgtcgtctgaactgcgtaaccgggggattccatcccgaagcgaagttttg
ggaatcttgcagcgggcaaacacttggtctgtgtgtgaacgtgaccgccaggaagctata
tttttagggaagcaggctatcggggtcttaggccagggtaagagcaaagtcatgctgggc
ttgccggcgcagactgttgattttgccgaagacagcaaggcacagtgggttgatctgaaa
agtgttgcaggattggaacgcccagtggctccttgttatttgacagagagcggaattgat
ccttcgtttactgcttggctgcaaaacaaaatgggagaacctttggcggaggccaatagc
gctcttcaggtatggaagcttgctgcggaacaattgtcaagtaaccctgtgaaccgccaa
tccagatag

DBGET integrated database retrieval system