KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_2694Help
Entry
Dhaf_2694         CDS       T00822                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Carbon fixation pathways in prokaryotes
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:dhd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dhaf_2694
   00630 Glyoxylate and dicarboxylate metabolism
    Dhaf_2694
   00640 Propanoate metabolism
    Dhaf_2694
   00650 Butanoate metabolism
    Dhaf_2694
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Dhaf_2694
  Lipid metabolism
   00071 Fatty acid degradation
    Dhaf_2694
   00072 Synthesis and degradation of ketone bodies
    Dhaf_2694
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dhaf_2694
   00310 Lysine degradation
    Dhaf_2694
   00380 Tryptophan metabolism
    Dhaf_2694
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Dhaf_2694
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Dhaf_2694
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Dhaf_2694
Enzymes [BR:dhd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Dhaf_2694
Exosome [BR:dhd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dhaf_2694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2899949..2901310
Genome map
AA seq 453 aa AA seqDB search
MSEKVVQKLEHTRKNYYKDAEIAAYGERKPDYSTLGRKIENTYARQRQVVCVEACRTPYG
KSLGALLEYDAAQLGALAIKEVLRRTKGKVAPGEVDYVIMGHVVQAGSGQVSSRQATLLA
GLPEHVPSITVNKVCSSGVKTIDLGAQMIALGRAEIVIAGGQESMSNIPFSLPDMRRGRK
MGLPTIDCVDLMVKDGLWDSFYERHMAIHGSEVADEFGYSREEQDEWALHSQLAASAAIA
AGKLDAEIFPVAVKTGKETLEKDEGPRANTTLEGLAKLGPVFDHISAVTGKPGSVTAGNA
PGTNDGGDVCLLMSRAKADELGLKPLFSIVDYAEVSQPTKDIATVPGLSIKKVLEQNKLT
LEDIKLIEINEAFAAVALVSARTILGMTKEQMYEKVNVNGGAIAYGHPIGATGARIVMTL
AYELKRRGGGYGVCGICAGHAQGDAMLIYVEPD
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaaaagtggttcaaaaacttgaacacaccagaaaaaactattacaaagacgct
gaaatcgccgcttacggtgaaagaaagccggattactcaaccctgggaagaaaaattgag
aatacttatgccaggcagcgccaggtcgtctgtgtggaagcctgccggacaccctatggc
aagtcgctgggggccctgctggaatacgatgcggctcaattgggagcactggctattaaa
gaagttctccggcgaaccaagggaaaagtcgccccaggtgaagtggattatgtgatcatg
ggtcatgtcgtccaggcgggcagcggtcaggtctccagccgccaggccactcttttggca
ggattgccggaacatgtcccttccattacggtcaataaagtatgctcctccggtgtcaaa
accattgacctgggggcgcaaatgattgccttaggcagggcggaaatcgtcattgccggt
gggcaggagagcatgagcaatattcctttctcactgccggacatgcgcagaggcaggaag
atggggcttcccactattgactgtgttgatctgatggtcaaggacggactttgggattcc
ttctatgagcgccatatggccattcacggttccgaagtggccgatgaattcggctacagc
cgggaggagcaggacgaatgggccctccattcacagctcgccgcctcggcagcgattgcc
gccgggaagcttgatgctgaaatctttccggtggccgttaaaacgggcaaagaaaccctg
gaaaaagatgaaggcccccgtgccaatactaccctggaaggcttggctaagcttggcccc
gtttttgatcacatcagtgctgtaaccgggaagcctggcagcgtaaccgccggcaatgcc
ccgggaacaaacgacggcggggatgtctgtctcctgatgagccgggcgaaagccgatgaa
ctcggcctcaaaccgcttttctccattgtggactatgccgaagtctcccagcccaccaag
gatattgctaccgttcccgggctttccatcaagaaggtcttagaacaaaataagctgacc
cttgaggatataaagctcatcgaaatcaatgaagcctttgctgcggtcgccctggtgagt
gcccgcacgattctgggcatgaccaaggaacaaatgtatgaaaaagtcaatgttaacggc
ggggccattgcctatggtcatcccattggagcgaccggagccagaattgtcatgacctta
gcctatgagctcaagcgccgggggggcggttatggagtatgtggtatctgtgcagggcac
gcccagggcgatgccatgctcatctatgtggagcctgattga

DBGET integrated database retrieval system