KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_2768Help
Entry
Dhaf_2768         CDS       T00822                                 

Definition
(GenBank) peptidase M42 family protein
Organism
dhd  Desulfitobacterium hafniense DCB-2
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2969056..2970117)
Genome map
AA seq 353 aa AA seqDB search
MNNAQLSSAKEFLKQLSENSGVSGYEETLAPLVLAAFTPLADQVGQDALGNIYAHKKGTQ
GRYKIMLAAHMDEIGLMVKGIEPSGFLRFTPVGGVDQRTLLSQEVIVHGRKPVLGVIGST
PPHLMTAGEEKAVKAEQMGIDVGMTFEQIKEVIQVGDIITLRRNTLELLNHVLAGKSFDD
RAGVVVMKICLEELQRLQHAHDVIAVSTTQEEVGYRGATTSAYSLNPDLAIAIDVTHAST
PDTKGQVEKELGKGPAIALGPNIHPFVYEELVKAAKEARIPYQNHPVPGRSGTDAWAIQV
TQAGVPTGLVSIPLRYMHTSVETIDMQDVILTGKLLAYFIAGLPEDLEGRVCY
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
ttgaataacgcgcaattatccagcgcgaaggaatttctaaaacaactctcggaaaattcc
ggtgtatcaggatatgaggaaactcttgctcccttggtcctggcagcgttcaccccctta
gccgatcaggtcggccaggatgccttgggcaatatttatgcccacaaaaaggggacccag
gggcgctataaaatcatgctggccgcccatatggatgaaataggcctcatggtcaaaggg
atcgaacccagcggcttcctgcgttttaccccagtagggggtgtggatcagcgtaccctg
ctttcccaggaagtcatcgtccatggcagaaagcctgtcctgggggtcatcggctccact
ccgccccatttaatgaccgcaggtgaagaaaaagccgtgaaagcagaacagatggggatc
gatgtgggaatgacttttgagcagatcaaggaggtcattcaggtgggggatatcattacc
ctgcggcgcaatactttggaattactgaatcatgtcctggccggcaagtcctttgatgac
cgggcaggagtggtcgttatgaaaatatgtctggaagaactgcaaaggctgcagcatgct
catgatgtcattgccgtcagcaccactcaggaagaggttggctatagaggggcaaccacc
agtgcctatagcttaaatccggatttggccatcgctatcgatgtcacccatgccagcact
ccggataccaaagggcaagtagaaaaagagttggggaaaggtccggccattgccctgggg
cccaatatccatcccttcgtctatgaagaattggttaaggcggccaaagaagcccgtatc
ccttatcaaaaccatcccgttccgggacgcagcggcacagatgcctgggctattcaggtg
acacaagccggtgtgcccacgggcttagtgtccatacctttacgctatatgcatacctct
gtggaaaccattgatatgcaggatgtgatcctgaccggaaaactgctggcctattttatc
gccggacttcctgaagatttggagggaagagtatgctactaa

DBGET integrated database retrieval system