KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_3053Help
Entry
Dhaf_3053         CDS       T00822                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
dhd00260  Glycine, serine and threonine metabolism
dhd00750  Vitamin B6 metabolism
dhd01100  Metabolic pathways
dhd01110  Biosynthesis of secondary metabolites
dhd01120  Microbial metabolism in diverse environments
dhd01230  Biosynthesis of amino acids
Module
dhd_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dhd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dhaf_3053
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Dhaf_3053
Enzymes [BR:dhd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Dhaf_3053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ACL21076
JGI: Dhaf3053
UniProt: B8G015
Position
complement(3272724..3274208)
Genome map
AA seq 494 aa AA seqDB search
MLYESTRGNFPDQTGKEAIALGMVPVGGLFVPKELPQIHWEEVRGISYPELAQLIFKRYL
PDFPEEKCVETSKIYTDGVFDSDNPAPLVNVGDMGILELWHGPTAAFKDMALQALPHLLG
ESMQVLTHTDKVLILVATSGDTGKAALEGFKNVEGTEIMVFYPEHGVSTVQEQQMTTTDG
VNTKVVPVVGNFDQCQSAVKEIFGNPDLREKFKEQGIAFSSANSINWGRLLPQIIYYYWA
YLQGVESQRIRPGEKMNVVVPTGNFGNILAAYYAKEMGLPIHQLICASNENNVLTDFFSQ
GVYNRKRPFFVTSSPSMDILISSNFERFLYEVSGRDGSKVGKWYDDLQALGEFTVDSDTL
AKARKAVIAGWAGEADVLAVIQSVYKEHAYVLDPHTAVAVKVYQDYLRESGDNTFTMIAS
TASPFKFAKTVLEGIDADALEDDEWANLRKLREITGWSIPKGLQGLEDKETFGLEPVQPE
EIPELIQKVYIPNR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgttgtacgaaagcacgagagggaatttccctgatcaaactggaaaagaagcgattgcc
ttgggcatggttccggtaggggggttatttgttccgaaagaacttccgcaaattcactgg
gaggaagttcgcggcatttcctatccagaactggcccaattgatttttaaacgctatcta
cccgattttccggaggagaaatgtgttgagacttcaaaaatatacacggatggagttttc
gattcggataatccggctcccctggtgaatgtgggagatatgggaatactggagctatgg
catggtcctactgccgccttcaaagatatggccttgcaggctttgccccatcttttggga
gaaagcatgcaggttctcactcacaccgacaaggtgctgattttggtcgctacgtcagga
gatacgggaaaggccgccctggagggatttaaaaatgttgagggtacagagatcatggtc
ttttatcctgaacatggagtgagcactgttcaggagcagcaaatgaccacaactgatggg
gtcaacactaaagtagttcccgtcgtcggtaatttcgatcagtgtcagtccgctgtgaaa
gagatttttggcaatcctgacttaagagaaaaatttaaagaacagggcattgccttttct
tcggcaaactctattaactggggaaggcttttgccgcaaatcatctattactattgggct
tatttacaaggggtggaatcgcaacgaattcgtcccggagaaaaaatgaatgtggtggta
cccacagggaacttcggcaacattcttgccgcttattatgccaaggaaatgggattgcct
attcatcaactcatttgtgcctccaatgagaataatgtgctgacagatttcttcagccaa
ggagtgtataaccgcaagcgtccttttttcgtgacctcttctccttcgatggatatttta
atatccagtaattttgagcgcttcctttacgaagtttccgggagggatgggtcaaaggta
ggaaagtggtatgacgacctgcaggcccttggcgaatttactgtggattcggatacttta
gccaaggccaggaaagcagtcattgccggatgggccggtgaggcggatgtgctggcggtc
atacaatccgtatataaagagcatgcctatgttctggatccccatacagccgtagcggtg
aaagtatatcaagattatcttcgggaatcaggagacaacacctttaccatgatcgcctca
acagccagtccctttaaatttgccaaaaccgtcttagagggcattgatgcagatgcctta
gaagatgatgaatgggcgaatttgcggaagctgagggagattaccggctggagcataccc
aaaggtctccaggggttagaggataaagagactttcggtttggagccggtacaacctgag
gagattccggaactcatccagaaggtttatatacccaatagatag

DBGET integrated database retrieval system