KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_3089Help
Entry
Dhaf_3089         CDS       T00822                                 

Definition
(GenBank) Succinate--CoA ligase (ADP-forming)
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
dhd00020  Citrate cycle (TCA cycle)
dhd00640  Propanoate metabolism
dhd00660  C5-Branched dibasic acid metabolism
dhd00720  Carbon fixation pathways in prokaryotes
dhd01100  Metabolic pathways
dhd01110  Biosynthesis of secondary metabolites
dhd01120  Microbial metabolism in diverse environments
dhd01130  Biosynthesis of antibiotics
dhd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dhd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dhaf_3089
   00640 Propanoate metabolism
    Dhaf_3089
   00660 C5-Branched dibasic acid metabolism
    Dhaf_3089
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Dhaf_3089
Enzymes [BR:dhd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Dhaf_3089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 CPSase_L_D2 GARS_A Citrate_bind ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ACL21112
JGI: Dhaf3089
UniProt: B8G051
Position
complement(3306354..3307631)
Genome map
AA seq 425 aa AA seqDB search
MARFLEYQGKEWLAKAGMPVPKGRPASTPEEAREAAEWIGGPVAVKGQVQAGGRGKAGIV
KLVNTPDEAAAAAAEILSKTVKGLPVRKVLVEEKLDIKKEFYCSFVVNGAKEARSPMLMF
SVEGGMDIESVPEDKLLKINVDPINGLQTYDAVDLAAKAGIAPEELTKFAKFLTKLSQTY
KKYDCMTLEINPFVMTGNGNLICADCKMEIDNSSVGRHPEFGFDIARDLPGEPTELDYIG
WSIEETDARGTGFLMNMGYDEVSPGYVGYHPIGGGSAMMGLDALNQVGLKPANYADTSGN
PVASKIYRVAKSVLSQPNIDGYLLGGFMMANQEQWHHAHAIVKVLREILPTQKPGLPCVL
LLCGNREDESLEILKTGLADLMTSDGPGKRIEIYGKEYVTDTKFIGERLLALSKDYRAEK
EAQGK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggcaagatttctagagtatcaaggtaaagaatggcttgcaaaagcaggaatgccggta
cctaagggtcgtccggcatcgacccccgaagaagcaagggaagccgctgaatggattggc
ggtcctgttgcggtaaaaggtcaggtacaagcgggtggtcgtggtaaagctgggattgtt
aaactggttaacactcccgatgaggcagcagcagctgctgctgaaattctctccaaaaca
gtaaaaggcttaccggtgcgcaaagttcttgtggaagaaaaattggatatcaaaaaagag
ttctattgctcctttgtcgttaacggagcaaaggaagcccgttcaccaatgcttatgttc
agcgttgagggcggtatggatattgaaagtgtcccggaagacaaattactgaagatcaat
gtggaccccatcaatggactgcagacttatgatgcggtagatttggctgctaaagcagga
atagctccggaagaattaacgaagtttgctaaatttttgacgaaactttctcaaacttat
aagaaatacgactgtatgacccttgagatcaaccccttcgttatgacagggaatggcaat
ctcatctgtgccgactgcaagatggaaatcgacaacagttccgtaggccgtcatcccgag
ttcggctttgacatcgcccgcgacctgcctggtgagcccacagagttggactacatcggc
tggagcattgaggaaaccgatgcccgtggcacaggcttccttatgaatatgggatacgat
gaagtcagccccggatatgttggctatcatcccatcggcggcggttcggcgatgatgggc
ttggatgctcttaatcaagtaggtctgaagccggccaactatgccgacaccagcggcaac
cccgtagcttccaaaatttatcgcgttgccaaatcggtgctttcccagcccaatattgac
ggctacctacttgggggctttatgatggccaaccaggaacaatggcatcatgctcatgct
atagtcaaagtgcttcgtgaaatcctccccactcaaaaaccaggattgccttgtgtgctc
ctgctttgcggcaaccgggaagatgaatctttggaaattctcaaaaccggactggctgat
ctgatgaccagcgatggacctggaaagagaattgagatttacggcaaagaatatgtaacc
gatacgaagttcattggtgaaagacttttagctctgagcaaagactatcgggctgagaaa
gaagctcaaggaaagtag

DBGET integrated database retrieval system